KEGG   Laccaria bicolor: LACBIDRAFT_171643Help
Entry
LACBIDRAFT_171643 CDS       T01044                                 

Definition
isocitrate lyase icl
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
lbc  Laccaria bicolor
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:lbc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LACBIDRAFT_171643
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    LACBIDRAFT_171643
Enzymes [BR:lbc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     LACBIDRAFT_171643
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 538 aa AA seqDB search
MSSERARFAHEVAQVEQWWKNPRFARVKRPYTAADVVAKRGTLAIQYPSNVQGKKLWKLL
SEHAKRGTPSHTYGALDPVQVTQMAKYLETVYVSGWQSSSTASSTNEPGPDLADYPSNTV
PNKVEHLFMAQLFHDRKQREARSSLSEAELAKTPVVDYLRPIVADADTGHGGLTAVMKLT
KMFVEKGAAGIHVEDQAPGTKKCGHMAGKVLVPIQEHINRLVAIRLQYDIMGVENLAIAR
TDSEAATLITSNIDGRDHAFILGATNPSQPPLNDVMVEAELAGKSGDQLQAIEDQWISSA
NLELFSTTLAKALGKQGATKAALDKLVARVSRVSHPEAVAIAQKEFGLRTIPYWNWDSPR
TREGYYRYQGGTQCAIHRAIAFAPYADLLWMETKKPILSQAQEFAHGVHAARPGHWLAYN
LSPSFNWEAAGLNDKDMQGYVWELGKLGFVWQFITLGGLHSNAYISDLFAQNFAKTGMKA
YVELVQRKERELGTDVLTHQKWSGADYADNLIKTVTGGVSSTAAMGAGVTESQFGSKL
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atgtccagcgagagagcccgttttgcacacgaagttgctcaggtcgagcagtggtggaag
aacccccgctttgcacgagtaaaacgtccctatactgccgcggatgtcgtcgctaagagg
ggcacacttgccatccaatatccttcaaacgtgcagggcaagaagctttggaaactgctc
agcgaacacgccaagcgcggcactccatcccacacctatggagcgttggatcctgtccag
gtaacccaaatggcgaagtatctcgagactgtctatgtctcaggttggcagtcgtcaagc
acggcttcgagcacaaacgagccgggtcctgatcttgccgattatccatcgaacactgtc
ccgaacaaagttgaacatttattcatggctcagctgttccacgaccgaaagcaaagagag
gcacgctcttcgctgtccgaggctgagctcgccaaaactcccgtcgttgactatcttcgc
cccatagtcgcagacgccgataccggtcatggtggtctcactgctgtaatgaaattgacc
aagatgttcgtcgaaaagggtgccgccggcattcacgttgaggatcaagcaccaggaacc
aaaaagtgtggccacatggcgggcaaggttttggtgcctatccaggagcatattaaccgt
ctcgttgctattcgtctgcaatatgacatcatgggggttgagaatttggccatcgccaga
acggactccgaggcggccaccctcatcacctcgaacattgacggccgggatcatgctttt
attctgggagctacaaacccgtcacaaccccctctgaacgatgtcatggtggaggctgag
cttgctggcaaaagtggcgaccaactccaagcgatcgaggatcaatggatctccagtgct
aacctggagttgttctccacaacgttggcaaaggcgcttgggaagcagggtgcgaccaag
gctgcccttgataagttggtggcgcgcgtttcgcgggtttcccacccagaagccgttgcc
attgcgcagaaggaatttggcctgcgaaccattccatactggaattgggacagcccaagg
actcgcgagggttactacaggtaccaaggtggtacccagtgtgctatccaccgcgccatt
gccttcgccccgtacgctgaccttctctggatggaaacgaagaagccaatcttgtcgcaa
gctcaagaattcgctcatggtgttcacgcggctcgcccaggtcattggttggcgtacaac
ttgagtccatccttcaactgggaggctgcaggtttgaacgacaaagatatgcaaggctat
gtctgggagctgggcaagcttggattcgtctggcaattcatcactcttggtggtctgcat
tcgaatgcctacatctcggacctcttcgcccaaaattttgcgaagactggcatgaaggcc
tacgttgagctcgtccagcgtaaagagcgcgagttgggcactgatgttcttactcatcaa
aagtggagcggcgctgattatgccgacaatttgatcaagacagtcactggaggagtttcg
tcaacagctgccatgggtgctggtgtgacagaatcgcagtttggctcaaagctttga

DBGET integrated database retrieval system