KEGG   Laccaria bicolor: LACBIDRAFT_176615Help
Entry
LACBIDRAFT_176615 CDS       T01044                                 

Definition
arginase (EC:3.5.3.1)
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
lbc  Laccaria bicolor
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:lbc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    LACBIDRAFT_176615
  Amino acid metabolism
   00330 Arginine and proline metabolism
    LACBIDRAFT_176615
Enzymes [BR:lbc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     LACBIDRAFT_176615
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 312 aa AA seqDB search
MASHSRFIREPKTVAIVGCPFSGGQPKPGVDKGPIHLVEAGLISQFEGLGWNVKFEGHHQ
FEDIKTNDDPPVGILKNPKLVSRVTESIAKVVGEHVKNGELAVTLGGDHSLAMGTISGTL
STHPEACVIWVDAHADINTIESTGSGNIHGMPVSFLLGLGSKVPEFSWVKPLLKPENLVY
IGLRDVDAGEKAILRDNKIKAFSMHEVDRYGIGKVVEMALDHVNPNRDRPIHLSFDVDAL
DPTVAPSTGTPVRGGLTFREGHFICEAIYETGLLVALDLMEVNPSLEDEASVKQTVAVGC
SLLRSGLGETLL
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atggcttcccattctcgcttcattcgtgagcccaaaactgttgccattgtcggttgccct
ttcagtggtggtcagcccaaacctggcgtcgacaaaggtccgatccatctcgtagaggct
gggctaatcagtcagtttgaaggccttggatggaacgtcaagtttgaaggtcaccaccag
ttcgaagacatcaagaccaacgacgaccctccggttggaattctaaagaatccgaagcta
gtttcacgggttaccgagtcgattgcgaaggttgtcggcgagcatgtcaagaacggagag
ttagctgtcactttgggtggagaccattctttggccatgggcaccatttcggggacactg
agcacccatcctgaggcctgcgtcatttgggttgacgcgcatgcggatatcaacactatc
gaatccacaggatcaggaaacatccacggtatgcccgtttcattcctacttggactgggc
agcaaagtcccagaattctcttgggtgaagcctcttttgaagccggaaaatctcgtttat
attggtttacgcgatgttgatgccggtgaaaaggctattttgcgcgacaacaagataaaa
gcttttagcatgcacgaagttgacaggtacgggataggaaaggtggtagaaatggcgctg
gaccacgtcaatcctaaccgagatcggccgatacatttgagttttgatgtggacgcgctg
gaccctacagtagcaccctccacaggaactccagttcgaggaggcttgaccttcagagaa
ggtcatttcatttgtgaggccatctatgagaccggcttactggttgcattggatttaatg
gaggtcaatccttccctcgaggatgaggcgagtgtgaagcagacagttgccgtcggatgt
tccttgttgagatcaggactaggagaaacactcttgtaa

DBGET integrated database retrieval system