KEGG   Laccaria bicolor: LACBIDRAFT_178529Help
Entry
LACBIDRAFT_178529 CDS       T01044                                 

Definition
cytochrome c C1
Orthology
K08738  
cytochrome c
Organism
lbc  Laccaria bicolor
Pathway
Sulfur metabolism
Metabolic pathways
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:lbc00920]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 108 aa AA seqDB search
MPFAAGDSAKGASLFKTRCAQCHTVGAGEPNKVGPNLHGLFGRKSGQVEGFSYTAANVNK
GVTWEEETLFEYLENPKKYIPGTKMAFAGLKKEKDRSDLITYLKESTA
NT seq 327 nt NT seq  +upstreamnt  +downstreamnt
atgcctttcgctgctggtgactctgccaaaggtgcttccctcttcaagacccgctgcgcg
caatgccacaccgtcggcgctggtgagcctaacaaggttggccctaatcttcatggactc
tttggccgcaagtctggccaggttgagggattctcatacaccgctgccaacgtcaacaag
ggagttacatgggaagaggagactctctttgagtacctagagaaccctaaaaagtacatc
cccggaaccaagatggcgtttgctggattgaagaaggagaaggacaggagtgacctcatc
acctacctcaaagaatcgactgcctaa

DBGET integrated database retrieval system