KEGG   Laccaria bicolor: LACBIDRAFT_181719Help
Entry
LACBIDRAFT_181719 CDS       T01044                                 

Definition
hypothetical protein
Orthology
K01440  
nicotinamidase [EC:3.5.1.19]
Organism
lbc  Laccaria bicolor
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lbc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    LACBIDRAFT_181719
Enzymes [BR:lbc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     LACBIDRAFT_181719
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 223 aa AA seqDB search
MALKSLDRTALIVIDLQNDFVSGSLPVPGGAEIVDTVNRLVDLPFALKIATKDFHPANHV
SFALRHDLPVFTKATIFHPSDKARTKGLEQVLWPAHCVVGTSGANFVPGLNTDDFTTIIH
KGVDPDIESYSAFRDIWHYQNSDLTRVLHKENVTDVFFVGLAGDYCVKYTALDSASFGFD
TWVVRDAVRCISDDNIAWDEMEKKGIRFVESAELIAKFSTLEA
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atggcgttgaaatctctagatcgaacagccctcatagtcatcgacctgcagaatgacttt
gtatctgggagccttcccgttcccgggggcgcagaaatcgtcgatacagtgaaccgcctc
gtagatcttccgtttgcactcaagatcgcaaccaaagatttccacccagccaaccacgtc
tctttcgcactcaggcacgacttgcctgtttttacaaaggccaccatcttccatccttct
gataaagctaggacaaagggtctggaacaggtgttatggcctgctcactgcgttgtcggt
acaagcggcgcgaatttcgtgccaggcttgaatacagatgacttcaccaccataattcac
aaaggagtggatcccgacatagagtcttactccgcgtttcgcgacatatggcattaccaa
aactccgatctcactcgtgttctgcataaggaaaatgtgacggatgtcttcttcgtgggt
ctagctggtgattattgcgtcaagtacactgcacttgattcagcatcctttggattcgac
acgtgggtagtacgcgatgctgtcagatgcatctccgacgacaacattgcgtgggatgag
atggagaagaagggcattcggtttgtcgagtcagccgagttgattgcgaaattttcaacc
ttggaagcctga

DBGET integrated database retrieval system