KEGG   Laccaria bicolor: LACBIDRAFT_182374Help
Entry
LACBIDRAFT_182374 CDS       T01044                                 

Definition
(RefSeq) hypothetical protein
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
lbc  Laccaria bicolor
Pathway
lbc00230  Purine metabolism
lbc01100  Metabolic pathways
Module
lbc_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:lbc00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    LACBIDRAFT_182374
Enzymes [BR:lbc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     LACBIDRAFT_182374
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_kin AAA_16 AAA_33 RsgA_GTPase MMR_HSR1 AAA_22 RNA_helicase AAA_18 KAP_NTPase AAA_29 NACHT ABC_tran ATPase_2 AAA_14 AAA NTPase_1 AAA_24 Roc AAA_28 AAA_5 T2SSE TRM cobW Septin
Motif
Other DBs
NCBI-GeneID: 6070233
NCBI-ProteinID: XP_001875241
JGI: 182374
UniProt: B0CUJ4
AA seq 204 aa AA seqDB search
MSPRPDFLRPLVLSGPSGVGKSTLLNRLFSEFPDKFGFSVSHTTRSPRPGELHGKQYFFV
THQKFKDLIQEGAFIEYAEFSSNFYGTSFATVRQVEQQGKRCILDIEAQGVRQIKATDLN
PIYLFISPPSMTVLRARLQNRGTETDASLQKRLATALKEIQFAKEPNVHDLVIINDDLDR
AYDLFKRVAQGEKVTGDALPPLND
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcctcgtcctgattttctacgtccccttgttctctctgggccatcgggtgttggg
aagagtactcttctgaatcgtctcttttctgaatttccagataaatttgggttcagcgtc
tcccacaccactcgcagtccacggccaggagagcttcatggaaagcagtacttcttcgtc
acccaccagaagttcaaagatctgattcaagaaggagcgttcattgagtacgcagaattt
tccagcaatttctatggcaccagcttcgcaactgttcgtcaggtagaacaacagggcaag
cgctgtattttagacatagaggcgcagggcgtccgtcaaataaaagcaacagatctgaat
cccatctacctgttcatctcccctccttcgatgactgtcctccgcgccagacttcagaat
cgtgggacggagacagacgcgtcccttcagaagcgccttgcaactgccttgaaagaaatt
cagtttgcaaaggagcccaacgtacatgatctcgtcatcatcaatgacgacctcgaccgc
gcgtacgatctttttaagagagtagctcaaggggaaaaagttactggggatgctcttcct
ccgttaaacgactaa

DBGET integrated database retrieval system