KEGG   Laccaria bicolor: LACBIDRAFT_182604Help
Entry
LACBIDRAFT_182604 CDS       T01044                                 

Definition
glycoside hydrolase family 20 protein
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
lbc  Laccaria bicolor
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Glycosphingolipid biosynthesis - globo series
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lbc00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    LACBIDRAFT_182604
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    LACBIDRAFT_182604
   00603 Glycosphingolipid biosynthesis - globo series
    LACBIDRAFT_182604
   00604 Glycosphingolipid biosynthesis - ganglio series
    LACBIDRAFT_182604
   00511 Other glycan degradation
    LACBIDRAFT_182604
Enzymes [BR:lbc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     LACBIDRAFT_182604
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 352 aa AA seqDB search
MSWVKMNTLHWHVVDSQSFPLVIPGFEALSEKGAYNPASVYTPKDVQDIVAYAAARGIDV
MAEIDTPGHTSVISKAFPEHIACAEATPWSLFANEPPAGQLRLASPSTISFTANLISAAA
SMFPSKFFSTGGDEINPNCYAKDASTQNDLSSQGKTFEEALDTFTQATHASVHAAGKRAV
VWEEMVLAHNVTLRSDTAVMVWISSANVAAVAQKGFKIIHAASDYFYLDCGHGGWVGDNV
NGNSWCDPFKTWQKSYSFDPAAGLTDTQKGLVLGGQHLLWTEQSNPSNLDSIVWPRAASS
AELFWTGPGGDVSKALPRLHDVAYRFIRRGVRAIVLQPEWCALRAGACDLFA
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgtcctgggtcaagatgaacaccctgcactggcacgttgtcgattcccaatccttccct
ctagtcatccccggattcgaagcattatcagaaaaaggcgcatataatcccgcgtctgta
tataccccaaaagacgtgcaagatatcgtcgcgtacgcagcagcgcgcggaatagacgtg
atggctgaaattgataccccaggtcacacctccgtcatatccaaagcgttccccgaacac
attgcttgcgcagaagcaaccccatggagcctgtttgcaaacgaaccccctgctggccaa
ctccgcctagcctccccttcaacaataagcttcaccgcaaatcttatttccgcagctgcg
tccatgttcccttccaagttcttcagcacgggcggggacgaaatcaacccaaactgttac
gcgaaggatgcttcgacgcagaatgatctttcatcacagggaaaaacattcgaggaagcg
ctggatacgttcacgcaagctacccatgcctctgtacacgctgctgggaagagggctgta
gtttgggaggagatggtgcttgcgcataatgtgacgcttcggagtgataccgccgtcatg
gtatggatttcatcagccaacgtcgcggcagtcgcacagaaggggttcaagatcatccac
gccgcttctgattacttttacttggactgtgggcatggtgggtgggtgggtgataacgtt
aatgggaatagctggtgtgatcctttcaagacttggcaaaagtcatactcgttcgatcct
gctgcaggcttgacggatacgcagaaggggctcgtgttgggaggtcaacacctcttatgg
accgaacaatccaatccctccaacctcgacagcatagtctggccacgcgcagcttcgtct
gctgagctcttctggactgggccaggaggtgacgtttccaaagcgcttcctaggcttcat
gacgtcgcgtaccgctttattcgacgtggtgttcgtgcgattgtgttgcagcccgagtgg
tgtgctttgagagctggggcttgtgatttgtttgcatga

DBGET integrated database retrieval system