KEGG   Laccaria bicolor: LACBIDRAFT_184047Help
Entry
LACBIDRAFT_184047 CDS       T01044                                 

Definition
(RefSeq) hypothetical protein
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
lbc  Laccaria bicolor
Pathway
lbc00260  Glycine, serine and threonine metabolism
lbc00750  Vitamin B6 metabolism
lbc01100  Metabolic pathways
lbc01110  Biosynthesis of secondary metabolites
lbc01230  Biosynthesis of amino acids
Module
lbc_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:lbc00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LACBIDRAFT_184047
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    LACBIDRAFT_184047
Enzymes [BR:lbc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     LACBIDRAFT_184047
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-GeneID: 6074615
NCBI-ProteinID: XP_001878951
JGI: 184047
UniProt: B0D421
AA seq 544 aa AA seqDB search
MKYFSTRGGDQKLSFEETVLTGLAPNGGLYIPENIPSLPSDWRTNWKDYSFVDLSVAVLS
LYISPNEISEQELRTLAEKSYRTFRHPDVTPLKKLGDKTFILELFHGPTFAFKDVALQLL
GNLFEFFLLRRNAKKIPGEQQETLTVVGATSGDTGSAAIYGLRNKANISIFILHPKGRVS
PIQEAQMTTVTDANVHNVAVKGTFDDCQDIVKALFADKEFNSEHRLGAVNSINWARILAQ
TVYYFLSFFHFQSQLPEGTSLEDVEIQYVVPTGNFGDILAGYYAKKMGLPMGKLVVATNA
NDILARFWKTGRYEKVDSSAVEGEGAAAPAGGSSNGKQGTDASGVKETLSPAMDILVSSN
FERLLWYLAYETAEGEDDAARRTATSKTLDTWMYKVKIDGRVEVPVAALEAGRKDFLAER
ISDEMTLTTIQSYFDGQPSYVADPHTAVGLAAAGIIAPKNSPNTYQIVLSTAHPAKFSEA
VSKALEGSSHFNFDRDVLPQEFHGLLEKEKRVIDVERPDIDLVKGVIGRFAKSDEHTAVE
AGSV
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atgaagtacttctcaacgcgtggaggggaccagaagctctctttcgaagagacagtcctc
acaggcctcgctcctaatggtggtctctacatcccagaaaacatcccttcgcttccatcg
gactggagaaccaactggaaagactactcttttgtagatctctccgttgccgttctatcc
ctctacatatccccaaacgagatatcggagcaggagcttaggacactggcggagaaatcg
tacaggacgtttaggcaccccgatgttacgccactgaaaaagctgggcgacaagacgttc
atattggagctgttccatggcccaacatttgcgttcaaggatgttgcgctgcagttgctt
ggcaatttgttcgaattcttcctgctccgccgtaatgcgaagaaaataccgggggagcag
caggaaacattgactgtggttggcgcgacgagtggggatactggaagcgctgctatttat
ggccttcgaaacaaggcaaacatttctatctttattcttcatccaaagggtcgtgtttct
cctattcaagaagcgcaaatgacgacggtaacggacgccaatgtccacaacgtcgctgtg
aaagggacatttgacgattgtcaggacatcgtcaaagccctattcgctgacaaagagttc
aattcagaacaccggctaggcgccgtcaactccatcaactgggcacgcatcctcgcacag
accgtctactacttcctttccttcttccacttccaatcccaacttcccgagggcacctca
ctggaagacgtagaaatccaatacgtcgtcccgaccggaaactttggcgacatcctcgca
ggttactatgccaagaaaatggggctgcctatgggcaagctcgtcgtggcgacgaatgcg
aatgatattctggctaggttctggaagacagggaggtacgagaaagtcgactctagcgcg
gtagagggtgaaggcgctgcggctcctgctggagggtcttcgaatgggaagcaggggacg
gacgctagtggcgtgaaggagacgttgagtcctgccatggatatccttgtgtccagcaac
tttgaaaggttgctgtggtaccttgcgtacgagaccgcagagggtgaagatgatgctgcg
aggagaacggctacgagcaagacgcttgacacatggatgtacaaggtgaaaattgacggc
cgcgtcgaagtccctgttgctgctctggaagcgggtcgtaaggacttcttggccgagcgg
atttccgatgaaatgaccttgaccactatccagtcttactttgacggccaaccatcgtac
gtcgctgacccacacaccgctgtcgggctagcagctgcggggatcatcgcacccaagaac
tccccaaatacataccaaatcgtcctatccacggcccacccagccaagttctccgaggcc
gtgtcgaaagcccttgaggggtcctcgcacttcaactttgatcgggacgttctcccgcaa
gagttccatgggttactagaaaaagagaagagggtcatcgatgttgagaggcctgatatt
gacttggttaaaggcgtcatcggaaggtttgcaaagtcggatgaacatacggctgttgag
gctggaagtgtatga

DBGET integrated database retrieval system