KEGG   Laccaria bicolor: LACBIDRAFT_184047Help
Entry
LACBIDRAFT_184047 CDS       T01044                                 

Definition
hypothetical protein
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
lbc  Laccaria bicolor
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:lbc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    LACBIDRAFT_184047
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LACBIDRAFT_184047
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    LACBIDRAFT_184047
Enzymes [BR:lbc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     LACBIDRAFT_184047
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 544 aa AA seqDB search
MKYFSTRGGDQKLSFEETVLTGLAPNGGLYIPENIPSLPSDWRTNWKDYSFVDLSVAVLS
LYISPNEISEQELRTLAEKSYRTFRHPDVTPLKKLGDKTFILELFHGPTFAFKDVALQLL
GNLFEFFLLRRNAKKIPGEQQETLTVVGATSGDTGSAAIYGLRNKANISIFILHPKGRVS
PIQEAQMTTVTDANVHNVAVKGTFDDCQDIVKALFADKEFNSEHRLGAVNSINWARILAQ
TVYYFLSFFHFQSQLPEGTSLEDVEIQYVVPTGNFGDILAGYYAKKMGLPMGKLVVATNA
NDILARFWKTGRYEKVDSSAVEGEGAAAPAGGSSNGKQGTDASGVKETLSPAMDILVSSN
FERLLWYLAYETAEGEDDAARRTATSKTLDTWMYKVKIDGRVEVPVAALEAGRKDFLAER
ISDEMTLTTIQSYFDGQPSYVADPHTAVGLAAAGIIAPKNSPNTYQIVLSTAHPAKFSEA
VSKALEGSSHFNFDRDVLPQEFHGLLEKEKRVIDVERPDIDLVKGVIGRFAKSDEHTAVE
AGSV
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atgaagtacttctcaacgcgtggaggggaccagaagctctctttcgaagagacagtcctc
acaggcctcgctcctaatggtggtctctacatcccagaaaacatcccttcgcttccatcg
gactggagaaccaactggaaagactactcttttgtagatctctccgttgccgttctatcc
ctctacatatccccaaacgagatatcggagcaggagcttaggacactggcggagaaatcg
tacaggacgtttaggcaccccgatgttacgccactgaaaaagctgggcgacaagacgttc
atattggagctgttccatggcccaacatttgcgttcaaggatgttgcgctgcagttgctt
ggcaatttgttcgaattcttcctgctccgccgtaatgcgaagaaaataccgggggagcag
caggaaacattgactgtggttggcgcgacgagtggggatactggaagcgctgctatttat
ggccttcgaaacaaggcaaacatttctatctttattcttcatccaaagggtcgtgtttct
cctattcaagaagcgcaaatgacgacggtaacggacgccaatgtccacaacgtcgctgtg
aaagggacatttgacgattgtcaggacatcgtcaaagccctattcgctgacaaagagttc
aattcagaacaccggctaggcgccgtcaactccatcaactgggcacgcatcctcgcacag
accgtctactacttcctttccttcttccacttccaatcccaacttcccgagggcacctca
ctggaagacgtagaaatccaatacgtcgtcccgaccggaaactttggcgacatcctcgca
ggttactatgccaagaaaatggggctgcctatgggcaagctcgtcgtggcgacgaatgcg
aatgatattctggctaggttctggaagacagggaggtacgagaaagtcgactctagcgcg
gtagagggtgaaggcgctgcggctcctgctggagggtcttcgaatgggaagcaggggacg
gacgctagtggcgtgaaggagacgttgagtcctgccatggatatccttgtgtccagcaac
tttgaaaggttgctgtggtaccttgcgtacgagaccgcagagggtgaagatgatgctgcg
aggagaacggctacgagcaagacgcttgacacatggatgtacaaggtgaaaattgacggc
cgcgtcgaagtccctgttgctgctctggaagcgggtcgtaaggacttcttggccgagcgg
atttccgatgaaatgaccttgaccactatccagtcttactttgacggccaaccatcgtac
gtcgctgacccacacaccgctgtcgggctagcagctgcggggatcatcgcacccaagaac
tccccaaatacataccaaatcgtcctatccacggcccacccagccaagttctccgaggcc
gtgtcgaaagcccttgaggggtcctcgcacttcaactttgatcgggacgttctcccgcaa
gagttccatgggttactagaaaaagagaagagggtcatcgatgttgagaggcctgatatt
gacttggttaaaggcgtcatcggaaggtttgcaaagtcggatgaacatacggctgttgag
gctggaagtgtatga

DBGET integrated database retrieval system