KEGG   Laccaria bicolor: LACBIDRAFT_184184Help
Entry
LACBIDRAFT_184184 CDS       T01044                                 

Definition
(RefSeq) triose phosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
lbc  Laccaria bicolor
Pathway
lbc00010  Glycolysis / Gluconeogenesis
lbc00051  Fructose and mannose metabolism
lbc00562  Inositol phosphate metabolism
lbc01100  Metabolic pathways
lbc01110  Biosynthesis of secondary metabolites
lbc01130  Biosynthesis of antibiotics
lbc01200  Carbon metabolism
lbc01230  Biosynthesis of amino acids
Module
lbc_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
lbc_M00002  Glycolysis, core module involving three-carbon compounds
lbc_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:lbc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LACBIDRAFT_184184
   00051 Fructose and mannose metabolism
    LACBIDRAFT_184184
   00562 Inositol phosphate metabolism
    LACBIDRAFT_184184
Enzymes [BR:lbc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     LACBIDRAFT_184184
Exosome [BR:lbc04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   LACBIDRAFT_184184
  Exosomal proteins of bladder cancer cells
   LACBIDRAFT_184184
  Exosomal proteins of melanoma cells
   LACBIDRAFT_184184
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TIM CutC
Motif
Other DBs
NCBI-GeneID: 6074900
NCBI-ProteinID: XP_001879541
JGI: 184184
UniProt: B0D692
AA seq 251 aa AA seqDB search
MTRQFFVGGNFKLNPITLESKKSLISGLNKAELDPSTEVVIAPPSIYLISVKDIVRKDVK
VAAQNCYFKESGAFTGEISPKQLVDAGIPYVILGHSERRTIFKETSELIATKTRAALDAG
LKVILCIGETLQEREAGKTAEVCEEQLKAVVEVLKEADWSNVVIAYEPVWAIGTGKVATS
AQAQEAHVDVRAYLAKAISAAVANDTRIIYGGSVTAVNCKELATQQDVDGFLVGGASLKP
EFADIVNAKKA
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgacccgtcaattcttcgtcggagggaacttcaagctgaaccccatcaccctggagtcg
aagaagtctctgatttcaggactcaacaaggctgagctcgatccctcgaccgaggtcgtt
atcgcaccaccctcgatctacctgatctcggtcaaggatatcgttcgcaaagatgttaaa
gtggccgcgcagaactgttacttcaaggaatctggagcgttcactggagagatcagcccc
aagcagcttgtagacgccgggatcccatacgttatcctcggtcactctgagcgccgcaca
atcttcaaagaaacctccgagctcatcgcaaccaagacccgcgcagccctcgacgcaggc
ctcaaagtcatcctctgcatcggagaaaccctccaggagcgcgaagcaggaaagactgca
gaagtctgcgaagagcagctgaaagccgtcgttgaggttctcaaggaggccgactggagc
aacgtcgtgattgcatacgaacccgtgtgggctatcggcaccggtaaggtcgccacatcc
gcgcaagcgcaagaggcgcacgtcgacgtgcgcgcctacctcgccaaggccatctcagcg
gccgtagcgaacgacactcgtattatttacggaggaagcgtcactgcggtcaactgcaag
gaacttgcaactcaacaagacgttgatggatttttggttggaggggcctcgctcaaaccg
gaattcgcagatatcgtaaatgccaagaaagcgtag

DBGET integrated database retrieval system