KEGG   Laccaria bicolor: LACBIDRAFT_184356Help
Entry
LACBIDRAFT_184356 CDS       T01044                                 

Gene name
SPT-1
Definition
serine palmitoyltransferase
Orthology
K00654  
serine palmitoyltransferase [EC:2.3.1.50]
Organism
lbc  Laccaria bicolor
Pathway
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:lbc00600]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 508 aa AA seqDB search
MEGASATLEPLFAFLAHALATAETTFNRLPGSAVIQRYVKSSHQNDPGRTILELILVVFA
IRTLLQSRTRADRNGKHFIQFSDKEIDELVDEWSPEPLAQPLTAIEQADLAAVPIVAGPN
GPKPKLVATGKTATNLTSFNFTGLAGNEHIKQKAVETLRKYGLGSCGPPGFYGTLDVHID
LERDIADFLGTEAAILYSQGFSTISSVIPAFCKRGDIIVADRGVNFAIQKGIQISRSTVR
WFDHNDLNSLEDVLIGVEKERKKRRGPLTRRFIITEGIFERDGVMVDLPKLIELKYKYKY
RLILDESFSFGTVGRTGRGLTELYNVPATKVDMLLGSVAIGLCSSGGFCAGSQNVVDHQR
INGPSFVFSASMPALLAVSASEGINILRSTPSILTSLQENVQAAHAILDRVDCITIPSHP
ASPVIHIQDSASQDWDIDVEERLLQDVVDEALAQGVILSRAKRLRGQEMVDVRPSIRLAL
TSALTKKETEKAVGIVKATLVKVLGKRR
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atggaaggcgcttcagcgacactagagcccctcttcgcttttttggcgcatgcgctggca
acggctgagacgacgttcaacagactccctggctcagctgtcatccagcgatatgtgaag
agctctcaccagaacgatcctggcagaaccattttagaacttatactagtcgtattcgcg
attaggacgctgcttcagtcgcgtacacgagcagataggaatggcaaacattttattcag
ttcagcgacaaggaaatcgacgagctcgtggacgaatggtcacctgagcccctcgcccaa
cccctcacggccatcgagcaggctgacctggctgctgtgcccatcgtggctggtcccaat
ggccccaaaccgaaattggtggctacgggaaagacggctacgaatctgacgagcttcaat
ttcacgggcttggcggggaacgaacatatcaagcagaaagccgtcgagacgctgaggaag
tatgggttgggaagctgtgggccgccagggttttatggaactcttgacgtgcatatagac
ttagagcgtgacattgcggactttctcggtacagaggccgccattttgtattcgcaaggc
ttctccaccatttcgtccgtcattccggcgttctgcaagcgaggcgacatcattgttgct
gatcgtggagtcaatttcgcgattcagaagggcatccagatatctcgctccactgtccgt
tggtttgatcataacgatttgaatagcctcgaggacgttttaattggtgtggagaaggag
aggaaaaagcgcaggggacctcttactaggagatttatcattacggaagggatttttgag
agggacggtgttatggttgatttgccgaaattgattgaactcaagtacaaatacaaatac
cgccttatcctcgacgaaagtttctcgtttggaactgttggacgaactggccgcggctta
acagaactgtataacgttcctgcaacaaaggtagacatgctgctgggttccgtcgccatc
ggtctctgctcttctggtgggttctgtgctggttctcaaaatgtagtcgatcaccagcgt
atcaacggtccctcgtttgtcttctctgcctccatgccggccttgcttgccgttagcgcc
tcagaaggcatcaacatccttcgctccaccccctccatcctcacaagccttcaagaaaat
gtacaagcggcacacgccatcctcgatcgcgtcgactgcatcaccataccttcacatccc
gcgtcacccgtcattcacatccaagactctgcgagtcaagattgggatatcgatgtggag
gagaggcttctccaagacgtggtggatgaagcacttgcacagggggttattttatctagg
gcgaagaggttgagggggcaggagatggtggatgtcagaccgagtatacggttagctttg
acaagtgctcttacgaagaaagagacggaaaaggcggttgggattgttaaggctacgctt
gtgaaggtgttggggaagaggaggtga

DBGET integrated database retrieval system