KEGG   Laccaria bicolor: LACBIDRAFT_184494Help
Entry
LACBIDRAFT_184494 CDS       T01044                                 

Definition
(RefSeq) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
lbc  Laccaria bicolor
Pathway
lbc00040  Pentose and glucuronate interconversions
lbc00052  Galactose metabolism
lbc00500  Starch and sucrose metabolism
lbc00520  Amino sugar and nucleotide sugar metabolism
lbc01100  Metabolic pathways
lbc01130  Biosynthesis of antibiotics
Module
lbc_M00361  Nucleotide sugar biosynthesis, eukaryotes
lbc_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lbc00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    LACBIDRAFT_184494
   00052 Galactose metabolism
    LACBIDRAFT_184494
   00500 Starch and sucrose metabolism
    LACBIDRAFT_184494
   00520 Amino sugar and nucleotide sugar metabolism
    LACBIDRAFT_184494
Enzymes [BR:lbc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     LACBIDRAFT_184494
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGP
Motif
Other DBs
NCBI-GeneID: 6075851
NCBI-ProteinID: XP_001880115
JGI: 184494
UniProt: B0D8B2
AA seq 504 aa AA seqDB search
MSSSLMPRSDSFNARVRGTSHIDFKTATTGVAAKAMRNEISRLVATVDDPATKKAFDTEM
QSFFYLFTRYLAERAKSVDLDWDRIKSPAADQIVPYADLPKPKDTKNLSKLAVLKVNGGL
GTSMGMTGAKSALEVKDDMTFLDLTVRQIEHLNTTSRVDVPLILMTSFNTHDDTLRIIKK
YANQQLRITTFNQSRYPRIFKETLLPSPKRADDDKKNWYPPGHGDLYNALLHSGVLDQLL
AEGKEYLFVSNSDNLGAVVDESILQHMIDTKAEFLMEVTDKTKADIKGGTLIDYDGSIRL
LEIAQVPSEHVEDFKSIRKFKIFNTNNLWINLKALKNVMENEGMELEIIINPKTTDDGHA
VVQLETAAGAAIKHFKNAHGINVPRKRFLPVKSCSDLLLIKSDIYSLQHGQLVINEQRMF
ETTPVIKLGDHFKKIQQFQKRFKKIPKILELDHLTVTGDVYFGRNVTLRGTVIVVANEGQ
RIDIPDGCILENRLLSGNLNMIEL
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagctcgttgatgccccgcagcgactccttcaacgcacgcgttcgcggcaccagc
cacattgatttcaaaacggctaccactggcgtcgccgcgaaggcaatgcgcaatgagatc
agccgcctcgtagccaccgttgacgaccccgccacaaaaaaggcgttcgacacagagatg
cagtccttcttctatctcttcacccgctatctcgccgagcgcgcaaaaagcgttgacctc
gattgggatcggatcaagtcccccgctgcagatcaaattgttccctatgcagacctcccc
aagccaaaggataccaagaatctgagcaaactcgctgttctcaaagtcaatggtggtctt
ggaacatccatgggcatgaccggagccaagagtgctctggaggtcaaggatgacatgacc
ttcctcgatctgaccgtgaggcagattgagcatctgaacacgaccagccgcgtcgatgtc
cccctcatcctcatgacctctttcaacacgcatgatgatacccttcgcatcatcaagaaa
tatgcgaaccaacaattacgcattaccaccttcaatcagtcccgataccccaggatcttc
aaagaaactctgcttccatcccccaagcgtgctgacgacgacaagaagaactggtacccc
cccggtcacggtgatttgtacaatgctctcttgcactccggcgtccttgaccaactactg
gccgagggcaaggagtacctcttcgtgtccaactcagacaatttgggagctgtcgtcgat
gaaagcatcttgcaacacatgatcgatactaaagcagagttcctcatggaggtgacggac
aagaccaaagctgacatcaagggtggaaccttgattgattatgatggttcaatccgattg
cttgaaattgctcaagttccttcagaacacgtggaggatttcaaatcaattcgcaagttc
aagatcttcaacacgaacaatctgtggatcaatttgaaagccctcaagaatgttatggag
aacgaaggcatggagttggagatcatcatcaaccccaagaccacggatgatggtcatgct
gttgttcagttggagactgctgctggagctgccatcaagcacttcaagaacgcgcacggt
attaacgtgccccgcaagcgtttccttcctgtcaagagttgctccgatctccttctcatc
aagagcgacatttattctcttcaacatggacaacttgtcatcaacgagcagaggatgttt
gaaacgactcccgttatcaagcttggagaccacttcaagaagatccaacaattccagaag
cggttcaagaagatccctaagatcttggaacttgatcacttgactgtcactggagacgtg
tattttggtcgcaatgtcacccttcgcggaaccgtgattgttgttgccaatgaggggcag
aggatcgatattccagacggctgcattttggagaacaggctgttgtcaggcaacttgaac
atgattgagctttaa

DBGET integrated database retrieval system