KEGG   Laccaria bicolor: LACBIDRAFT_184494Help
Entry
LACBIDRAFT_184494 CDS       T01044                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
lbc  Laccaria bicolor
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, eukaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lbc00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    LACBIDRAFT_184494
   00052 Galactose metabolism
    LACBIDRAFT_184494
   00500 Starch and sucrose metabolism
    LACBIDRAFT_184494
   00520 Amino sugar and nucleotide sugar metabolism
    LACBIDRAFT_184494
Enzymes [BR:lbc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     LACBIDRAFT_184494
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 504 aa AA seqDB search
MSSSLMPRSDSFNARVRGTSHIDFKTATTGVAAKAMRNEISRLVATVDDPATKKAFDTEM
QSFFYLFTRYLAERAKSVDLDWDRIKSPAADQIVPYADLPKPKDTKNLSKLAVLKVNGGL
GTSMGMTGAKSALEVKDDMTFLDLTVRQIEHLNTTSRVDVPLILMTSFNTHDDTLRIIKK
YANQQLRITTFNQSRYPRIFKETLLPSPKRADDDKKNWYPPGHGDLYNALLHSGVLDQLL
AEGKEYLFVSNSDNLGAVVDESILQHMIDTKAEFLMEVTDKTKADIKGGTLIDYDGSIRL
LEIAQVPSEHVEDFKSIRKFKIFNTNNLWINLKALKNVMENEGMELEIIINPKTTDDGHA
VVQLETAAGAAIKHFKNAHGINVPRKRFLPVKSCSDLLLIKSDIYSLQHGQLVINEQRMF
ETTPVIKLGDHFKKIQQFQKRFKKIPKILELDHLTVTGDVYFGRNVTLRGTVIVVANEGQ
RIDIPDGCILENRLLSGNLNMIEL
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagctcgttgatgccccgcagcgactccttcaacgcacgcgttcgcggcaccagc
cacattgatttcaaaacggctaccactggcgtcgccgcgaaggcaatgcgcaatgagatc
agccgcctcgtagccaccgttgacgaccccgccacaaaaaaggcgttcgacacagagatg
cagtccttcttctatctcttcacccgctatctcgccgagcgcgcaaaaagcgttgacctc
gattgggatcggatcaagtcccccgctgcagatcaaattgttccctatgcagacctcccc
aagccaaaggataccaagaatctgagcaaactcgctgttctcaaagtcaatggtggtctt
ggaacatccatgggcatgaccggagccaagagtgctctggaggtcaaggatgacatgacc
ttcctcgatctgaccgtgaggcagattgagcatctgaacacgaccagccgcgtcgatgtc
cccctcatcctcatgacctctttcaacacgcatgatgatacccttcgcatcatcaagaaa
tatgcgaaccaacaattacgcattaccaccttcaatcagtcccgataccccaggatcttc
aaagaaactctgcttccatcccccaagcgtgctgacgacgacaagaagaactggtacccc
cccggtcacggtgatttgtacaatgctctcttgcactccggcgtccttgaccaactactg
gccgagggcaaggagtacctcttcgtgtccaactcagacaatttgggagctgtcgtcgat
gaaagcatcttgcaacacatgatcgatactaaagcagagttcctcatggaggtgacggac
aagaccaaagctgacatcaagggtggaaccttgattgattatgatggttcaatccgattg
cttgaaattgctcaagttccttcagaacacgtggaggatttcaaatcaattcgcaagttc
aagatcttcaacacgaacaatctgtggatcaatttgaaagccctcaagaatgttatggag
aacgaaggcatggagttggagatcatcatcaaccccaagaccacggatgatggtcatgct
gttgttcagttggagactgctgctggagctgccatcaagcacttcaagaacgcgcacggt
attaacgtgccccgcaagcgtttccttcctgtcaagagttgctccgatctccttctcatc
aagagcgacatttattctcttcaacatggacaacttgtcatcaacgagcagaggatgttt
gaaacgactcccgttatcaagcttggagaccacttcaagaagatccaacaattccagaag
cggttcaagaagatccctaagatcttggaacttgatcacttgactgtcactggagacgtg
tattttggtcgcaatgtcacccttcgcggaaccgtgattgttgttgccaatgaggggcag
aggatcgatattccagacggctgcattttggagaacaggctgttgtcaggcaacttgaac
atgattgagctttaa

DBGET integrated database retrieval system