KEGG   Laccaria bicolor: LACBIDRAFT_184735Help
Entry
LACBIDRAFT_184735 CDS       T01044                                 

Definition
hypothetical protein
Orthology
K14298  
mRNA export factor
Organism
lbc  Laccaria bicolor
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:lbc00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    LACBIDRAFT_184735
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 356 aa AA seqDB search
MSFFSNTATNAATTNASQTAEKDVEVADPPTDSISSLSFSSQADYLAVGSWDNSVRIYEV
GAGGQTQGKAMYQHQGPVLDVCWNKDGTKIFSGGADNAGRMFDVTTGQASQVAQHDAPIR
VVAWVDAPQSGILATGSWDKTIKYWDLRTPSPVATVQLPERCYTFDVQYPLMVVGTAERH
IQIFNLTNPNTAYKTIQSPLKWQTRVVSCFTSSANSGFAVGSVEGRVAIQYVEEKDASNN
FSFKCHRRDSVPNAKDQALVFAVNDISFHPVHGTFSTCGSDGTIHFWDKDARTRLKTFDA
ATGPISTSAFNRNGSIFAYAVSYDWSKGHSGMTPGHPNKLMLHACKDEEVRKRARK
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgtctttcttttcaaataccgcaacaaacgcggcaaccaccaacgcttctcagaccgct
gaaaaggatgtcgaagtcgcagacccgcccacagactcaatatcctccttgtcattctca
agtcaggctgactacttggcagtaggaagttgggataatagcgtgcggatctatgaggtg
ggagcgggtggacaaacgcaaggaaaggcaatgtaccaacaccaagggcccgttctagat
gtgtgctggaacaaggatggcacaaaaatattctctggaggcgctgacaatgctggtcgc
atgtttgatgtgactacaggccaggcttcgcaagtcgcgcagcacgatgctcccatcagg
gtagtcgcttgggtagacgcacctcagtccggaatcctcgcgacgggaagctgggacaag
accattaaatactgggacctgcgaacaccaagtcctgtggccactgtacaactcccagag
cggtgttacacgtttgatgtccagtacccgctgatggtcgttgggacggcggaacgtcac
attcaaatcttcaacctgaccaatcctaacactgcttacaagaccatccagtcccctttg
aagtggcaaacacgggtagtttcttgtttcacctcgtcagcgaacagtggcttcgccgtg
ggtagtgtggaaggcagggtagccatccaatatgttgaagaaaaagacgcgtcaaacaac
ttttctttcaaatgccaccgacgtgattcagtccccaacgcgaaagaccaagcgttggta
ttcgctgtcaacgacatttcttttcatcctgttcatggaacattttctacttgtggttct
gacggtacaatccacttttgggacaaggacgctcgcacgcgtttaaagactttcgacgcc
gctacaggacctatttccaccagcgcattcaaccgtaacggttctatcttcgcctatgct
gtttcctacgactggtcgaaaggccattctggaatgactccgggacatcctaacaagtta
atgctgcacgcttgtaaagatgaagaggtcaggaagagggctagaaaataa

DBGET integrated database retrieval system