KEGG   Laccaria bicolor: LACBIDRAFT_184735Help
Entry
LACBIDRAFT_184735 CDS       T01044                                 

Definition
(RefSeq) hypothetical protein
  KO
K14298  mRNA export factor
Organism
lbc  Laccaria bicolor
Pathway
lbc03013  RNA transport
Brite
KEGG Orthology (KO) [BR:lbc00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    LACBIDRAFT_184735
Messenger RNA biogenesis [BR:lbc03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     LACBIDRAFT_184735
Chromosome [BR:lbc03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    LACBIDRAFT_184735
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 ANAPC4_WD40 eIF2A WD40_like Nup160
Motif
Other DBs
NCBI-GeneID: 6076366
NCBI-ProteinID: XP_001880691
JGI: 184735
UniProt: B0DA58
AA seq 356 aa AA seqDB search
MSFFSNTATNAATTNASQTAEKDVEVADPPTDSISSLSFSSQADYLAVGSWDNSVRIYEV
GAGGQTQGKAMYQHQGPVLDVCWNKDGTKIFSGGADNAGRMFDVTTGQASQVAQHDAPIR
VVAWVDAPQSGILATGSWDKTIKYWDLRTPSPVATVQLPERCYTFDVQYPLMVVGTAERH
IQIFNLTNPNTAYKTIQSPLKWQTRVVSCFTSSANSGFAVGSVEGRVAIQYVEEKDASNN
FSFKCHRRDSVPNAKDQALVFAVNDISFHPVHGTFSTCGSDGTIHFWDKDARTRLKTFDA
ATGPISTSAFNRNGSIFAYAVSYDWSKGHSGMTPGHPNKLMLHACKDEEVRKRARK
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgtctttcttttcaaataccgcaacaaacgcggcaaccaccaacgcttctcagaccgct
gaaaaggatgtcgaagtcgcagacccgcccacagactcaatatcctccttgtcattctca
agtcaggctgactacttggcagtaggaagttgggataatagcgtgcggatctatgaggtg
ggagcgggtggacaaacgcaaggaaaggcaatgtaccaacaccaagggcccgttctagat
gtgtgctggaacaaggatggcacaaaaatattctctggaggcgctgacaatgctggtcgc
atgtttgatgtgactacaggccaggcttcgcaagtcgcgcagcacgatgctcccatcagg
gtagtcgcttgggtagacgcacctcagtccggaatcctcgcgacgggaagctgggacaag
accattaaatactgggacctgcgaacaccaagtcctgtggccactgtacaactcccagag
cggtgttacacgtttgatgtccagtacccgctgatggtcgttgggacggcggaacgtcac
attcaaatcttcaacctgaccaatcctaacactgcttacaagaccatccagtcccctttg
aagtggcaaacacgggtagtttcttgtttcacctcgtcagcgaacagtggcttcgccgtg
ggtagtgtggaaggcagggtagccatccaatatgttgaagaaaaagacgcgtcaaacaac
ttttctttcaaatgccaccgacgtgattcagtccccaacgcgaaagaccaagcgttggta
ttcgctgtcaacgacatttcttttcatcctgttcatggaacattttctacttgtggttct
gacggtacaatccacttttgggacaaggacgctcgcacgcgtttaaagactttcgacgcc
gctacaggacctatttccaccagcgcattcaaccgtaacggttctatcttcgcctatgct
gtttcctacgactggtcgaaaggccattctggaatgactccgggacatcctaacaagtta
atgctgcacgcttgtaaagatgaagaggtcaggaagagggctagaaaataa

DBGET integrated database retrieval system