KEGG   Laccaria bicolor: LACBIDRAFT_184771Help
Entry
LACBIDRAFT_184771 CDS       T01044                                 

Gene name
LbGpx
Definition
glutathione peroxidase-like protein
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
lbc  Laccaria bicolor
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:lbc00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:lbc00480]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 161 aa AA seqDB search
MSDSGFYSLKAERPGGKEYSFSELKGKVVLIVNVASKCGFTPQYKGLQDLYLKYKDQNFV
ILGFPCNQFGGQEPEDDKGIEEFCTLNHGVTFPLMKKSDVNGDNTNEVYKWLKEEKSGIF
GLTRIKWNFEKFLVDKEGNVVQRWASTTTPQAIDEEVAKLL
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgtcagattctggattttattctctcaaggccgagcgtcctggaggcaaggagtactct
ttctccgaactgaagggaaaggttgtgctcatcgtcaacgttgcttcaaaatgcgggttc
actccacaatacaagggactgcaggatttgtacttgaagtacaaggatcagaacttcgtc
atccttgggttcccttgtaaccagtttggaggtcaagagccagaagacgacaaggggatc
gaagagttttgcacgctcaaccacggcgtcacattcccactcatgaaaaagtccgatgtc
aatggagacaataccaacgaggtctacaaatggctgaaggaagagaaatccgggatcttt
gggctcacgagaatcaagtggaatttcgaaaagttcctcgtcgacaaagaggggaacgtc
gttcaacgatgggcgtccacgacgacaccacaagcgattgacgaggaagttgcgaaactc
ttatga

DBGET integrated database retrieval system