KEGG   Laccaria bicolor: LACBIDRAFT_184771Help
Entry
LACBIDRAFT_184771 CDS       T01044                                 

Gene name
LbGpx
Definition
glutathione peroxidase-like protein
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
lbc  Laccaria bicolor
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:lbc00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    LACBIDRAFT_184771 (LbGpx)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    LACBIDRAFT_184771 (LbGpx)
Enzymes [BR:lbc01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     LACBIDRAFT_184771 (LbGpx)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 161 aa AA seqDB search
MSDSGFYSLKAERPGGKEYSFSELKGKVVLIVNVASKCGFTPQYKGLQDLYLKYKDQNFV
ILGFPCNQFGGQEPEDDKGIEEFCTLNHGVTFPLMKKSDVNGDNTNEVYKWLKEEKSGIF
GLTRIKWNFEKFLVDKEGNVVQRWASTTTPQAIDEEVAKLL
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgtcagattctggattttattctctcaaggccgagcgtcctggaggcaaggagtactct
ttctccgaactgaagggaaaggttgtgctcatcgtcaacgttgcttcaaaatgcgggttc
actccacaatacaagggactgcaggatttgtacttgaagtacaaggatcagaacttcgtc
atccttgggttcccttgtaaccagtttggaggtcaagagccagaagacgacaaggggatc
gaagagttttgcacgctcaaccacggcgtcacattcccactcatgaaaaagtccgatgtc
aatggagacaataccaacgaggtctacaaatggctgaaggaagagaaatccgggatcttt
gggctcacgagaatcaagtggaatttcgaaaagttcctcgtcgacaaagaggggaacgtc
gttcaacgatgggcgtccacgacgacaccacaagcgattgacgaggaagttgcgaaactc
ttatga

  All links  
No link information was found.   
DBGET integrated database retrieval system