KEGG   Laccaria bicolor: LACBIDRAFT_184962Help
Entry
LACBIDRAFT_184962 CDS       T01044                                 

Definition
(RefSeq) mitogen-activated protein kinase MAPK
  KO
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
lbc  Laccaria bicolor
Pathway
MAPK signaling pathway - yeast
AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:lbc00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    LACBIDRAFT_184962
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    LACBIDRAFT_184962
Enzymes [BR:lbc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     LACBIDRAFT_184962
Protein kinases [BR:lbc01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   LACBIDRAFT_184962
Chromosome [BR:lbc03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     LACBIDRAFT_184962
Exosome [BR:lbc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   LACBIDRAFT_184962
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
JGI: 
UniProt: 
AA seq 378 aa AA seqDB search
MPDPTQAPTKSKSAAPAQPTPRKVRFNVGTQYQVLDVVGEGAYGIVCSAVHRPSGRKVAI
KKIAPFDHSMFCLRTLRELKLLKFLSEAGVSENIISILDIIKPASIDAFKEVYLIQELME
TDMHRVIRTQDLSDDHAQYFIYQTLRALKALHSADVIHRDLKPSNLLLNANCDLKVCDFG
LARSVKTAEPSGTETGFMTEYVATRWYRAPEIMLTFKQYTKAIDVWSVGCILAEMLSGKP
LFPGRDYHHQLTLILDVLGTPTLDEFYAITTRRSRDYIRALPFRKRKPFAQLFPNANPLA
VDFLAKTLTFDPKKRITVENALAHPYLESYHDPEDEPVAPPLDPEFFEFDLHKDDISREQ
LKELLYDEIMSFQPAPIT
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgccagaccctacccaagcgcctacgaagtcgaaatcggcagcacctgcccagcccacc
ccgaggaaagtcaggtttaacgtcggcacccaataccaagttctcgatgtcgttggtgaa
ggcgcctatgggattgtgtgctctgccgtgcatcgaccaagtggtcgcaaggtcgctatc
aagaagatcgccccttttgaccattcaatgttctgcctgcggaccctccgggagctcaag
ctcctcaagttcttgagtgaggcgggtgttagcgagaatatcatttcaattttggacatc
atcaaaccagcctcaatagatgcgttcaaggaggtctacttgatccaagagcttatggag
actgacatgcatcgggttattcgaacacaagatctttctgacgatcacgcccaatatttc
atataccagactcttcgtgctttgaaagcactccattctgcagatgttatccatcgtgac
ctcaaaccctccaatctcctcctcaacgcgaattgcgacctgaaggtctgcgattttggg
cttgcgcggtctgttaagaccgctgagccatctggcacggagaccgggttcatgaccgag
tatgttgcgacccgttggtatcgtgcccccgaaattatgttgacgtttaagcaatacacg
aaggccattgatgtatggtcggtaggttgcattttggcagagatgctatctggcaagcca
ctctttccgggccgagactaccatcatcaattaactctcatcctcgacgtcctgggaacg
cccacacttgatgagttctacgccattaccacgcggcgttcgcgggattatatccgggca
ctcccattccggaaacgtaaaccgtttgcgcagctctttcccaatgcaaaccctcttgcg
gtagatttcttggctaaaaccttgacgttcgatcccaagaagcggattactgtcgagaat
gctctcgcgcatccctatctggaatcctaccatgacccggaagacgaacccgtggcaccg
cctttggaccctgagttctttgagtttgatttgcacaaggacgacatcagccgagaacag
ctgaaggaactcctatatgatgagatcatgtccttccaacccgcgccaattacatag

DBGET integrated database retrieval system