KEGG   Laccaria bicolor: LACBIDRAFT_185040Help
Entry
LACBIDRAFT_185040 CDS       T01044                                 

Gene name
HTB16202
Definition
histone H2B
Orthology
K11252  
histone H2B
Organism
lbc  Laccaria bicolor
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 146 aa AA seqDB search
MAPKPASTAGKAPVSTASKAPAKSTEGAKAAKKTAKAAAPADGEKKKRKKVRKETYSSYI
YKVLKQVHPDTGISNKAMAILNSFVNDIFERIATEASKLAAYSKKSTISSREIQTSVRLI
LPGELAKHAISEGTKSVTKFSSAGAK
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atggctcctaaacccgcttccaccgctggcaaagccccagtctcgaccgcttccaaggct
ccagccaaatcgacggagggtgcaaaggcagccaagaagacagcgaaagccgcagcgcct
gctgatggggagaagaagaagcgaaagaaggtccgaaaggagacttactcctcatacatc
tacaaagtccttaaacaggtccaccccgacaccggtatctccaacaaggcgatggccatc
ctcaacagcttcgtgaacgatatcttcgaacggattgccactgaagcttctaaactcgct
gcctactccaagaagtccaccatctcatcacgcgaaatccaaacatcagtgcgactcatt
ctgcccggtgaactcgccaaacacgcaatctcagaaggaaccaagtcggtaacgaagttc
tcatcggcgggcgcgaagtaa

DBGET integrated database retrieval system