KEGG   Laccaria bicolor: LACBIDRAFT_185040Help
Entry
LACBIDRAFT_185040 CDS       T01044                                 

Gene name
HTB16202
Definition
(RefSeq) histone H2B
  KO
K11252  histone H2B
Organism
lbc  Laccaria bicolor
Brite
Chromosome and associated proteins [BR:lbc03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    LACBIDRAFT_185040 (HTB16202)
Exosome [BR:lbc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   LACBIDRAFT_185040 (HTB16202)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF TFIID_20kDa CENP-W
Motif
Other DBs
NCBI-GeneID: 6076801
NCBI-ProteinID: XP_001881267
JGI: 185040
UniProt: B0DBJ7
AA seq 146 aa AA seqDB search
MAPKPASTAGKAPVSTASKAPAKSTEGAKAAKKTAKAAAPADGEKKKRKKVRKETYSSYI
YKVLKQVHPDTGISNKAMAILNSFVNDIFERIATEASKLAAYSKKSTISSREIQTSVRLI
LPGELAKHAISEGTKSVTKFSSAGAK
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atggctcctaaacccgcttccaccgctggcaaagccccagtctcgaccgcttccaaggct
ccagccaaatcgacggagggtgcaaaggcagccaagaagacagcgaaagccgcagcgcct
gctgatggggagaagaagaagcgaaagaaggtccgaaaggagacttactcctcatacatc
tacaaagtccttaaacaggtccaccccgacaccggtatctccaacaaggcgatggccatc
ctcaacagcttcgtgaacgatatcttcgaacggattgccactgaagcttctaaactcgct
gcctactccaagaagtccaccatctcatcacgcgaaatccaaacatcagtgcgactcatt
ctgcccggtgaactcgccaaacacgcaatctcagaaggaaccaagtcggtaacgaagttc
tcatcggcgggcgcgaagtaa

DBGET integrated database retrieval system