KEGG   Laccaria bicolor: LACBIDRAFT_185417Help
Entry
LACBIDRAFT_185417 CDS       T01044                                 

Definition
hypothetical protein
Orthology
K04646  
clathrin heavy chain
Organism
lbc  Laccaria bicolor
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:lbc00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    LACBIDRAFT_185417
Exosome [BR:lbc04147]
 Exosomal proteins
  Proteins found in most exosomes
   LACBIDRAFT_185417
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 1680 aa AA seqDB search
MAAVDSSKPIAFCEHLQLSSLGVQPASISFQTLTLESDHFICVREKINEQNQVVIIDLAD
ANNVLRRPISADSAIMHPSQKILALKAARTLQIFNIETKQKVKSHVNSEDIVFWKWVNET
TIGMVTESSVFHWTISDPTSPPQKIFDRHPTLAGAQIINYRVTSDEKWLVLIGISGNTTN
PSAFKVKGSMQLYSRERGVSQPIEGHAASFAEIKLDGHQNPTKLFTFAVRTATGAKLHVV
EIDHQSPDPPFTKKNVDVYFPPEATNDFPVAMQVSKKHGIIFLVTKYGFIHLYDLETGAC
VYMNRISGETIFVTAEHEATNGIIGVNKKGQVLSVNVDEQTIIPYILTTLNNTELAFKLA
SRANLPGADDLYIKQYQQLFQSGQYGEAAKVAANSPRGILRTVAVIESFKSAPTPPGGLS
PILQYFGILLEKGELNHLESIELARPVLQQGRKQLLEKWLKEHKLTCSEELGDIVRLHDM
NVALSVYLRANVPNKAIACFTETGQTDKIVRYAKTVGYTPDYVALLQHIMRTNPDKGAEF
AAQLVNDDSGPLVDVERVVDIFISQNMIQPATSFLLDALKDNKPEQGHLQTRLLEMNLVH
APQVADAILGNEMFTYYDRPRIANLCEKAGLLQRALEHYEDIADIKRAIVHTTGLQPDWL
VNYFSRLTTAQSMACLQEMLRVNIRQNLQVVIQIATKYSDILGPVKLIEMFESFKSFEGL
YYYLGSIVNLSEDPEVHFKYIQAATRTGQIREVERICRESNFYNPEKVKNFLKEAKLTDQ
LPLIIVCDRFDFVHDLVLYLYQNGLTKFIEVYVQRVNSVRTPQVVGGLLDVDCDEMTIKG
LLASVTGNFPIDELVHEVEQRNRLKLILPWLETRVQAGSQDPAVFNAVAKIYIDSNNNPE
QFLKENNLYEPLIVGKFCEARDPYLAYIAYAKGFCDEELISITNDNSMFKQQARYLIKRR
QPDLWAQVLVADNMHRRALIDQIVATALPECTDPDDVSITVKAFLQADLPIELIELLEKI
IIEPSPFSDNKNLQNLLLLTAIRADKGKVVGYINKLQNYDAAEIAKIATEHSLYEEALTI
YKKHEQHAMAINVLVEHIVSIDRGLEYANKVNQTEVWSRLAKAQLDGLRIKDSVDSYIKA
QDPSNFSEVIEIANHAGKHDDLVRYLQMARKSLREPKIDTELAYAYAKTDRLHDMEDFLG
MTNVADILEVGEKCFEDELYQAAKLLFTSISNWARLATTLIYLGENQSAVESARKAGNTQ
VWKQVHAACIEKSEFRLAQICGLHIIVHAEELSALIQLYERRGHFEEIISLLEAGLSLER
AHMGIFTELSILLSKYKPAKLMEHLKLFVSRINIPKVIKATEKAHLWPELVFLYIKYDEF
DNAALAMIERSSDAWEHNQFKEVIVRAANVEIYYKALSFYLQEQPTLLTDLLSVLIPRID
HSRVVRMFRPMDHIPLLRSYLIAVQHLNIEAVNDAYNDLLIEEEDYNTLRDSIDSFDNFN
NISLAKRLEKHELLEFRRLAAHLYKKNARWEESISLSKQDKLYKDAMVTAAVSASTEVAE
ELLSYFVDIGNKECFAALLYVCFDLLRSDIVEELSWQHGLTDFYMPYKIQVQRSLVEKLA
QLEKEVKERSKKDAQKEQTESEAPIINPGGFGSTLLLTNGFVGQAPPVNGIPYAMTGFGH
NT seq 5043 nt NT seq  +upstreamnt  +downstreamnt
atggccgcagtggactcctccaagcccatcgcattctgcgagcatcttcaactttcaagt
ttgggcgttcaaccagcctccatttcattccagactttgacactcgaatctgatcatttc
atttgcgtacgagaaaaaatcaatgaacagaaccaagtcgtcatcatcgacctcgccgat
gccaacaatgtcctacggcggccaatctccgccgactctgccattatgcacccctcacaa
aagattcttgctctgaaagctgctcgcacattgcaaatatttaacattgagaccaagcaa
aaggtcaaatctcatgtcaacagcgaggacatcgtgttctggaaatgggtcaatgaaact
accattggcatggtcaccgaatcatccgtgttccactggaccatctccgaccccacatcc
cctcctcagaagatctttgaccgccatcctactctcgctggagcccaaataatcaactac
cgcgtcacatctgatgagaagtggctagtcctcattggtatctctgggaacacaacaaac
ccatccgcattcaaggtcaagggctcaatgcaactttacagccgggaacgcggtgtcagt
caaccaatcgagggacacgccgcttccttcgccgagataaagctagacggccaccaaaat
cccacaaagctctttacattcgctgttcgcactgctacaggggcaaagttgcacgttgtc
gagattgatcatcaatcccccgatcctccgttcactaagaagaatgtcgatgtctacttc
ccacccgaggcgaccaacgatttccctgtggctatgcaggtatccaagaaacacggcatc
atctttctggtcacgaagtatggattcatccacttgtacgacctcgaaactggtgcttgc
gtatacatgaaccggatttctggcgagacgatatttgtcacggcagaacatgaagctacg
aacggcatcatcggtgtcaacaagaagggtcaagtgcttagcgttaatgttgacgagcaa
acgatcattccttacatattgacaacattgaacaacaccgaactagcattcaagctggcc
agtcgtgcaaatcttcctggtgcggatgatttgtacattaagcaataccagcaattgttc
cagagtggacagtatggcgaggccgccaaggtcgccgctaactcaccccgaggaatccta
cgcacagtcgctgtcattgaatcattcaagtcggcacctacgccacctggtggactctcc
cccatcctgcaatactttggtatcctcctcgagaagggtgaactaaatcatctagagtct
attgaacttgcgcgacccgttctccaacaaggaagaaagcaactcttggaaaagtggttg
aaggagcacaaattgacatgcagcgaggaacttggtgacattgtacggcttcatgacatg
aacgttgccctcagcgtttacctacgtgccaacgttccaaacaaagccatagcttgcttt
accgaaaccggtcagactgacaagatcgtgcgctatgcaaagacagtgggatatacaccc
gattatgttgccttgcttcaacacatcatgcgcaccaaccctgacaagggtgcggagttc
gctgctcagttggtgaatgacgattctggtcccctggttgacgtcgaacgggtggtcgat
atctttatttctcagaatatgatccaacctgcaacttcattcttattagatgcactcaaa
gacaacaagcccgagcaaggtcacctacaaactcgtcttttggagatgaatcttgtccac
gcgcctcaagttgctgacgctattctcggaaatgagatgttcacctactacgataggcca
aggattgccaacctttgcgagaaggctggtttgttacaacgggcgcttgaacactacgag
gatatcgcggatatcaagcgtgccatcgttcatactactggtcttcaacctgactggctt
gtcaactacttcagtcgcctgaccacggcgcaatccatggcctgtttacaagaaatgctt
cgggtcaacatccgtcaaaaccttcaagtcgttatccaaattgccacgaagtactctgac
attcttggaccagtcaaacttatcgagatgttcgagagcttcaagagcttcgaaggcctg
tattactaccttggctctatagtcaatctgtctgaagatccagaggtccacttcaaatac
atccaggctgctacccgtactgggcagatccgcgaggtcgaacgcatttgcagagaaagc
aacttctacaacccggagaaggtcaagaacttcctcaaagaggcgaagcttaccgatcaa
ctcccccttatcattgtctgcgaccgcttcgacttcgttcacgacctcgttctctacttg
tatcagaacggcctcaccaagtttatcgaggtctacgtgcagcgcgtgaactcggtcaga
actccccaggttgttggtggtctgttggacgttgactgcgatgagatgaccatcaagggt
ctcctcgcctcagtcactggcaatttccccatcgacgagcttgtccatgaagttgaacaa
cgcaataggctgaagttgatccttccttggcttgaaactcgtgttcaagctggcagccaa
gacccagcggtgttcaatgccgtagcgaagatctacattgacagcaacaacaaccccgaa
caattcctcaaagaaaacaatctttatgaacctttgattgttggaaagttctgcgaagct
cgggatccctatttggcgtatattgcctacgcgaaaggtttctgtgatgaagagttgatt
tcaatcacaaatgacaactccatgttcaagcagcaagcacgttacttgatcaagcgtcgc
cagcccgacctttgggcacaggttctcgtcgcggataacatgcatcgtcgggctcttatt
gatcaaatcgtggcgactgcccttccagagtgcacagatcctgacgatgtttcgatcacc
gttaaggccttcttgcaggcggatctgccgatcgagctcattgagttgctggagaagatc
atcatcgaaccgtcacccttcagtgacaacaagaatttgcagaaccttcttctcctcact
gctattcgcgcagacaagggcaaggttgttggttatatcaacaagctccagaactacgac
gctgccgaaatcgctaaaattgcgacggaacacagtctctacgaggaggctttgacaatt
tataagaagcatgagcagcatgcgatggcgatcaacgtgctggttgagcatattgtgtcg
attgatcgtgggcttgagtatgccaacaaggtcaaccaaacagaagtctggagcagactt
gccaaggcgcagcttgatggtctgcgtatcaaagactccgttgattcttatatcaaagca
caagatccctctaacttctcagaagtgattgagatcgccaatcacgctggcaagcacgac
gacctcgttcgttaccttcaaatggcacgcaagtctcttcgcgaacccaagattgacaca
gaacttgcctacgcatacgccaaaaccgaccgtctgcatgatatggaggacttcctgggc
atgaccaatgtcgcagacattctcgaagtcggagagaagtgcttcgaggatgagttatac
caagccgccaagctgttgttcaccagcatctcgaattgggcccgtttggcaacgactttg
atttatctcggagagaaccaatctgctgtggagagtgcccgcaaggctgggaacacacag
gtttggaaacaagtccacgctgcttgcattgaaaaatccgaattccgattggctcaaatt
tgtggtctacacatcatcgttcatgctgaggaactcagtgctctcattcaactttacgaa
cgtcggggtcactttgaggaaatcatcagccttctggaagccggattaagcttggaacgc
gcgcatatgggtatcttcaccgagctgtcgatcctgctcagcaagtacaagccagcgaaa
cttatggaacacttgaagctgttcgtttctcgcatcaatattcccaaggttatcaaggca
acggaaaaagcgcacctttggcccgaactcgtgttcctttacatcaaatatgatgagttt
gataatgctgctctggccatgattgaacgctcttctgacgcttgggaacacaaccaattc
aaagaagtcatcgttcgggcagcaaacgtggagatatactacaaggcattgtcgttctac
ctccaggagcagccaacgctgttgacagatctgcttagcgttctcatcccgcgtatcgat
catagtcgtgtcgttcgtatgttccgcccaatggaccacattcccctccttcgttcgtat
cttatcgccgtacaacatctcaacattgaagctgtcaatgatgcatacaacgacctcttg
attgaggaagaagattacaacacactccgtgattctatcgacagcttcgacaacttcaac
aacatcagccttgctaaacgcttggagaaacatgagcttcttgaattccgcagacttgct
gctcatttgtacaagaaaaacgcgcgatgggaagagtcaatatcgctctcgaaacaagac
aaattgtacaaggatgcaatggtcaccgccgctgtttcggcatcgacagaggttgccgag
gagctactttcatatttcgtggacattggaaacaaggagtgttttgccgctctcctatac
gtctgcttcgatctcctccgctccgacattgtggaggagctctcatggcaacacggcctc
actgacttctatatgccttacaaaattcaagtgcaacggtcgctggtggaaaaattggct
cagcttgagaaggaagtcaaggagcggtcgaagaaggatgcacaaaaggagcagacagag
tctgaggctcccatcatcaaccctggtggctttggtagtacattgctgttgacgaacggt
ttcgttggtcaagctcctccggtgaatggcattccatatgccatgactgggtttggtcat
tga

DBGET integrated database retrieval system