KEGG   Laccaria bicolor: LACBIDRAFT_185985Help
Entry
LACBIDRAFT_185985 CDS       T01044                                 

Definition
acetate--CoA ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
lbc  Laccaria bicolor
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:lbc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LACBIDRAFT_185985
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LACBIDRAFT_185985
   00620 Pyruvate metabolism
    LACBIDRAFT_185985
   00640 Propanoate metabolism
    LACBIDRAFT_185985
  Energy metabolism
   00680 Methane metabolism
    LACBIDRAFT_185985
Enzymes [BR:lbc01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     LACBIDRAFT_185985
Lipid biosynthesis proteins [BR:lbc01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   LACBIDRAFT_185985
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 660 aa AA seqDB search
MTEEQKPLIHPVAPRLKSGPKTPHVGPHIHAYRDAHKETVGHESDKWWAHKAREMLYWDR
PFHTVRSGGFQTGDIVWFPEGGLNASYNCVDRWAFKHPDKTAIIYEADEPGEGREITYAE
LLREVSSIANVLKSFGLKKGDTVSVYLPMTWQAVAVFLACARIGAVHSVVFAGFSAESLR
DRVQDCSSRVVITSDEGRRGGKPIATKAIVDAALRECPLVEHVLVLKRTGGQVGWTEGRD
KWYHEEIAKVPNYCPPEIMASEDPLFILYTSGSTGKPKGVVHTTGGYLLCAALTVKYVFD
VHPDDKFGCMADIGWITGHTYIVYGPLANGVTTTVFESTPVYPTPSRYWQTVEKHKLTQF
YTAPTAIRLLRRLGAHHVENHDLSSLRVLGSVGEPINPEAWDWYNEHVGKRQCAVVDTFW
QTETGSIVVTPFPGAIETKPGSATVPFFGIEPAILDPITGKELEGNNVEGVLVLKTPWPS
IARTIYKDHKRYLETYMNPYPGTFYTGDAAARDEHGYIWIKGRVDDVINVAGHRLSTAEI
ESALIMHKGVAETAVIGTTDEVTGQAVSAFVTLKPEYAYDPNDESGLVKELVLQVRKVIG
PFAAPKKVYIVSDLPKTRSGKIMRRIMRKVVAGEGDQLGDLSTVAEPATVEVIKKRVAGL
NT seq 1983 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaagaacagaaacctcttattcaccccgtcgctcctcgtttgaaatcaggtcct
aaaactcctcatgttgggccgcacatacatgcgtaccgcgacgcccacaaggaaactgtg
gggcatgagtcggataaatggtgggcgcataaagctagagaaatgctgtactgggaccgc
ccattccacacagtcagatcagggggcttccaaactggagatatcgtgtggttcccagag
ggtggactgaacgcatcgtacaactgcgtagatcgatgggctttcaagcatcctgacaag
accgccatcatctacgaagcggatgagcccggagagggaagggaaatcacttacgccgag
cttctccgcgaagttagcagcatcgccaatgttctcaaatcgtttggtctcaagaaaggc
gataccgtctccgtttaccttcctatgacgtggcaggcagtcgcagtcttcctcgcctgc
gcgcgtatcggcgccgtccactcggttgtatttgccggcttctctgctgaatctttgcgc
gatcgcgttcaagattgtagctcacgcgttgtcatcacctcagatgagggcaggaggggt
ggcaaaccaatcgcaaccaaggcgattgtcgatgctgcgctgagggagtgccctcttgtt
gagcatgtgctagttctgaaaaggacgggaggtcaggtcggttggacggaagggcgcgac
aagtggtaccacgaggagatcgcaaaggtgccaaactactgcccacctgagatcatggcg
tctgaggacccattgttcatcctctatacatccggatctaccggcaaaccaaagggtgtc
gtccacaccacaggagggtatcttctttgtgcagccctcactgtcaaatacgtctttgat
gtccaccccgatgacaagttcgggtgcatggctgacatcggttggatcactggtcacaca
tatattgtgtacggacctctcgccaatggagttactaccacggtgtttgaatccaccccc
gtataccccaccccatcccgctattggcagacagttgaaaagcacaaactcactcaattc
tacactgcgcccactgccatccgtcttctgcgacgccttggcgctcaccatgtcgagaac
cacgacctcagcagcctgcgcgtccttggcagcgtgggcgagcccatcaacccagaggcg
tgggattggtacaacgaacacgtcggtaagaggcagtgcgcggttgtggataccttctgg
caaacggagactgggtcgatcgtcgtcacaccgttccctggtgctatcgagaccaagccc
ggctccgcgactgtccccttcttcggcattgagcctgccattcttgatcccattacaggc
aaggagttggaaggtaataacgttgaaggtgttcttgtcctcaagacgccgtggccatcc
attgcccgtactatctacaaagaccataaacgctacctcgaaacctacatgaatccatac
cctggtaccttttatactggagatgcagcggcgcgtgatgagcacggatacatctggatc
aagggcagagttgacgacgttatcaacgtagctggccatcgtttgtctactgccgagatt
gagtcggcgcttatcatgcacaagggagttgctgaaactgctgtcatcggaaccactgac
gaagtaactggacaagccgtttccgccttcgttaccttgaaacctgaatacgcatacgat
cccaacgacgaatccggcttggtcaaggagctcgtgctccaagtgcgcaaggtaattgga
ccgttcgcggctccgaagaaggtttatatcgtgagcgacctgcccaagacgcgttccgga
aagatcatgcggaggattatgaggaaggttgtcgcgggagagggtgaccagcttggtgat
cttagcactgtcgctgagcctgctacggtggaggtcattaagaagagggtggcaggattg
taa

DBGET integrated database retrieval system