KEGG   Laccaria bicolor: LACBIDRAFT_187188Help
Entry
LACBIDRAFT_187188 CDS       T01044                                 

Definition
hypothetical protein
Orthology
K04441  
p38 MAP kinase [EC:2.7.11.24]
Organism
lbc  Laccaria bicolor
Pathway
MAPK signaling pathway - yeast
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway - yeast [PATH:lbc04011]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 374 aa AA seqDB search
MSFVKLSIFGTSFEVTTRYVDLQPVGMGAFGLVCSSKDQLTGASVAIKKIMKPFSTPVLS
KRTYRELKLLKHIQHENIISLSDVFISPLEDLYFVTELLGTDLHRLLTSRPLEKQFIQYF
LYQILRGLKYVHSAGVVHRDLKPSNILVNENCDLKICDFGLARIQDPQMTGYVSTRYYRA
PEIMLTWQKYDVAVDIWSTGCIFAEMLEGKPLFPGKDHVNQFSIITELLGTPPDDVIETI
CSENTLRFVQSLPKRERIPFSQKLRTADPDAIDLLEKMLVFDPRKRIDATQSLGHEYVSP
YHDPTDEPVAAEKFDWSFNDADLPVDTWKVMMYSEILDFHQVGEASITASGIPGGALAGP
DNGTLQANGIVLTA
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgtcgttcgtcaaactcagcatctttggaacttccttcgaggtcacaacaagatatgtc
gatctccaaccagttggaatgggtgcatttgggctcgtctgttcgagcaaggaccaactt
acgggcgcgtctgtggcgatcaagaagatcatgaagccattcagcacaccagtgctgagc
aaaagaacgtaccgggagctcaagcttctcaagcacatccaacatgaaaatattatcagc
ctcagcgatgtcttcatttctccccttgaggatctatactttgtgaccgaactcctcgga
actgacttacatcgactgctcacatctcgaccgctggagaaacagttcatccagtatttc
ctttaccaaattctgcgtggtctcaagtatgtgcactcagctggtgtggttcatcgtgac
cttaaaccgagcaacattcttgtaaacgagaactgtgatttgaagatctgcgattttggt
cttgcgcgcattcaggaccctcaaatgaccggctatgtctccacacgatattatcgcgcc
ccagaaatcatgttgacatggcaaaagtatgatgtcgccgtcgatatctggagtactggt
tgcattttcgcagagatgcttgagggcaaacccctcttcccaggcaaagatcacgttaat
cagttttcgatcatcacggaattattgggtacaccgcccgatgatgtcatcgaaaccata
tgcagcgaaaatacgcttcgatttgtccaaagcctgccaaaacgtgaacgcattcccttc
agtcagaagctacgcacagcggatcctgatgccattgaccttcttgagaagatgctggtg
ttcgatccccggaaacgtatagatgccacccaatcgctagggcatgaatacgtttcgccg
tatcacgatcccaccgatgaacccgtcgccgcagaaaagtttgactggagtttcaatgat
gctgatctcccagtggacacatggaaagtcatgatgtacagtgaaattttggacttccac
caagtaggcgaagcatcgatcacggcgagcggaattccagggggtgctctagctgggcca
gataatggcactctccaagcaaacgggatcgttcttactgcatga

DBGET integrated database retrieval system