KEGG   Laccaria bicolor: LACBIDRAFT_187542Help
Entry
LACBIDRAFT_187542 CDS       T01044                                 

Gene name
TRP1
Definition
(RefSeq) bifunctional tryptophan synthase TRP1
  KO
K01694  
tryptophan synthase [EC:4.2.1.20]
Organism
lbc  Laccaria bicolor
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:lbc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    LACBIDRAFT_187542 (TRP1)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LACBIDRAFT_187542 (TRP1)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    LACBIDRAFT_187542 (TRP1)
Enzymes [BR:lbc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     LACBIDRAFT_187542 (TRP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 701 aa AA seqDB search
MESLRRVFETKKAEGVPALVTFVTAGYPRKDDTVPILRAMQAGGADIIELGIPFSDPIAD
GPVIQETSTIALKNGIDYVTVLGQLREARNQGLTAPVLLMGYYNPLLAYGEDKAIQDAAE
AGANGFIMVDLPPEEAISFREKCRKYRLSYVPLIAPSTTLHRIKFLASIADTFIYVVSKM
GTTGSSEKIAMNNALPDILARIRSYTSIPLAVGFGVATRDHFNVVSDAGADGVVIGSRLV
SVIKDAPKEDISRHVEAYCREISQIGQPTRIRSALAAQLPSQELRDGIPASNVTSDPVVL
PARFGSYGGQYVPEALVDCLAELEDAHKAAITDPEFWKEFRSHFNYMNRPSQFYLAENLT
KDAGGANIWLKREDLNHTGSHKINNAIGQILLARRIGKTRIIAETGAGQHGVATATVCAK
FGLECVIYMGAEDVRRQALNVFRIEMLGGKVIPVHSGSCTLKDAVNEAMRDWVTNLSTTH
YLVGSAIGPHPFPTIVRDFQKVIGEEIKDQMQKARGKLPDVVVACVGGGSNAIGTFYDFI
KDKNVRLVGVEAGGEGIDGDRHSATLSMGQPGVLHGVRTYILQSKEGQIIETHSISAGLD
YPGVGPEHAWLKDSGRAEYVVATDEEALRGFRMLTQREGIIPALESSHAIWEAVRLAKSL
PKDQDLVVCLSGRGDKDVEQISELLPKWADILDWHVSPHAV
NT seq 2106 nt NT seq  +upstreamnt  +downstreamnt
atggaatcccttaggagagtcttcgaaacgaaaaaagcagagggcgtaccagcattggtc
accttcgtcactgcaggttatccacggaaggatgatacagtgcccattctgcgcgctatg
caggctggcggcgcagatataatcgaactcgggataccattctctgatcccatcgccgat
ggccctgtgatacaggagacgagcacaatcgcactcaaaaatggcattgactatgtcacg
gtacttggtcaactcagagaagcgcgaaaccaaggcctcactgcgcctgttcttctaatg
ggttactacaaccctttgctggcgtatggagaagacaaagctatacaggacgctgctgaa
gctggcgcgaatggatttattatggtcgatttaccaccggaggaagccatctcattccgc
gaaaagtgcagaaaatatagactttcatatgtccctctcattgcgccgtccaccacttta
caccggataaaattcctcgcatccatcgcggatacattcatctatgtggtttccaagatg
ggtacgacggggtcttcagaaaagattgcgatgaacaatgccctccccgatatccttgca
cggattcggtcatatacttccatcccattagcggtgggattcggtgttgctactcgtgat
cactttaacgttgtttctgacgcaggagcggacggagttgtcatcggaagtcgcctcgtt
tctgtcatcaaggacgccccaaaagaagatatctcgcgacacgtcgaagcatactgccgt
gagatcagccagataggacaacctacgcgaattcgatcagcgcttgcagcccaacttcct
tcgcaggagcttagggatgggataccagcaagtaatgtaacgtccgaccctgttgtttta
ccggcaagatttggttcatacggtggacaatatgttccagaggccttggttgattgtctt
gcggaacttgaggatgctcacaaggcggcaataacagatccagaattttggaaagagttt
cgaagccatttcaactacatgaaccgaccatcgcagttttacctggcagaaaacctaact
aaggatgcgggaggggcaaatatctggttgaagagagaagacctgaaccacacgggatct
cacaaaatcaacaatgctataggacagatcctgttggcgcggcggataggaaaaacgcgc
attatcgcagagactggtgcgggtcagcatggcgttgcaactgcaacggtttgcgccaaa
tttgggctggagtgtgtcatctacatgggtgcagaagatgtccggcgacaagccttgaat
gttttcagaattgagatgttaggtggaaaggtcattcccgtgcattctggttcgtgtacg
ctgaaggacgccgtcaacgaggcaatgcgcgattgggttaccaacctttcgacgactcat
tatcttgtcggctcagccatcggtccccatcccttccccaccatcgttcgggactttcag
aaggtcatcggtgaagaaattaaagaccaaatgcagaaggcacgcggtaaacttcctgac
gtcgttgtcgcttgcgttggtggaggaagtaacgctattggcacgttctacgattttatt
aaagataaaaacgttcgcctcgttggtgttgaggctggaggagaaggtattgacggggac
cgacacagcgcaacgttgtcaatgggacagccaggtgtgctgcacggcgttaggacatat
atcctgcagtccaaggaaggacaaattattgagacacattcaattagcgctggcctcgat
taccctggcgtaggacctgaacatgcttggctgaaggactcaggaagggcggaatatgtt
gttgccaccgacgaggaagcccttagaggctttagaatgctgacacagcgcgagggcatc
atccctgctctggagtcgtcacacgccatatgggaagccgtgcgtcttgccaaatcccta
ccaaaagatcaggatctcgtggtctgcctctctggccgtggagacaaggacgtcgaacaa
atttctgagcttctccctaagtgggctgacattcttgactggcacgtttctccacacgct
gtttag

DBGET integrated database retrieval system