KEGG   Laccaria bicolor: LACBIDRAFT_187542Help
Entry
LACBIDRAFT_187542 CDS       T01044                                 

Gene name
TRP1
Definition
bifunctional tryptophan synthase TRP1
Orthology
K01694  
tryptophan synthase [EC:4.2.1.20]
Organism
lbc  Laccaria bicolor
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:lbc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    LACBIDRAFT_187542 (TRP1)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LACBIDRAFT_187542 (TRP1)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    LACBIDRAFT_187542 (TRP1)
Enzymes [BR:lbc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     LACBIDRAFT_187542 (TRP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 701 aa AA seqDB search
MESLRRVFETKKAEGVPALVTFVTAGYPRKDDTVPILRAMQAGGADIIELGIPFSDPIAD
GPVIQETSTIALKNGIDYVTVLGQLREARNQGLTAPVLLMGYYNPLLAYGEDKAIQDAAE
AGANGFIMVDLPPEEAISFREKCRKYRLSYVPLIAPSTTLHRIKFLASIADTFIYVVSKM
GTTGSSEKIAMNNALPDILARIRSYTSIPLAVGFGVATRDHFNVVSDAGADGVVIGSRLV
SVIKDAPKEDISRHVEAYCREISQIGQPTRIRSALAAQLPSQELRDGIPASNVTSDPVVL
PARFGSYGGQYVPEALVDCLAELEDAHKAAITDPEFWKEFRSHFNYMNRPSQFYLAENLT
KDAGGANIWLKREDLNHTGSHKINNAIGQILLARRIGKTRIIAETGAGQHGVATATVCAK
FGLECVIYMGAEDVRRQALNVFRIEMLGGKVIPVHSGSCTLKDAVNEAMRDWVTNLSTTH
YLVGSAIGPHPFPTIVRDFQKVIGEEIKDQMQKARGKLPDVVVACVGGGSNAIGTFYDFI
KDKNVRLVGVEAGGEGIDGDRHSATLSMGQPGVLHGVRTYILQSKEGQIIETHSISAGLD
YPGVGPEHAWLKDSGRAEYVVATDEEALRGFRMLTQREGIIPALESSHAIWEAVRLAKSL
PKDQDLVVCLSGRGDKDVEQISELLPKWADILDWHVSPHAV
NT seq 2106 nt NT seq  +upstreamnt  +downstreamnt
atggaatcccttaggagagtcttcgaaacgaaaaaagcagagggcgtaccagcattggtc
accttcgtcactgcaggttatccacggaaggatgatacagtgcccattctgcgcgctatg
caggctggcggcgcagatataatcgaactcgggataccattctctgatcccatcgccgat
ggccctgtgatacaggagacgagcacaatcgcactcaaaaatggcattgactatgtcacg
gtacttggtcaactcagagaagcgcgaaaccaaggcctcactgcgcctgttcttctaatg
ggttactacaaccctttgctggcgtatggagaagacaaagctatacaggacgctgctgaa
gctggcgcgaatggatttattatggtcgatttaccaccggaggaagccatctcattccgc
gaaaagtgcagaaaatatagactttcatatgtccctctcattgcgccgtccaccacttta
caccggataaaattcctcgcatccatcgcggatacattcatctatgtggtttccaagatg
ggtacgacggggtcttcagaaaagattgcgatgaacaatgccctccccgatatccttgca
cggattcggtcatatacttccatcccattagcggtgggattcggtgttgctactcgtgat
cactttaacgttgtttctgacgcaggagcggacggagttgtcatcggaagtcgcctcgtt
tctgtcatcaaggacgccccaaaagaagatatctcgcgacacgtcgaagcatactgccgt
gagatcagccagataggacaacctacgcgaattcgatcagcgcttgcagcccaacttcct
tcgcaggagcttagggatgggataccagcaagtaatgtaacgtccgaccctgttgtttta
ccggcaagatttggttcatacggtggacaatatgttccagaggccttggttgattgtctt
gcggaacttgaggatgctcacaaggcggcaataacagatccagaattttggaaagagttt
cgaagccatttcaactacatgaaccgaccatcgcagttttacctggcagaaaacctaact
aaggatgcgggaggggcaaatatctggttgaagagagaagacctgaaccacacgggatct
cacaaaatcaacaatgctataggacagatcctgttggcgcggcggataggaaaaacgcgc
attatcgcagagactggtgcgggtcagcatggcgttgcaactgcaacggtttgcgccaaa
tttgggctggagtgtgtcatctacatgggtgcagaagatgtccggcgacaagccttgaat
gttttcagaattgagatgttaggtggaaaggtcattcccgtgcattctggttcgtgtacg
ctgaaggacgccgtcaacgaggcaatgcgcgattgggttaccaacctttcgacgactcat
tatcttgtcggctcagccatcggtccccatcccttccccaccatcgttcgggactttcag
aaggtcatcggtgaagaaattaaagaccaaatgcagaaggcacgcggtaaacttcctgac
gtcgttgtcgcttgcgttggtggaggaagtaacgctattggcacgttctacgattttatt
aaagataaaaacgttcgcctcgttggtgttgaggctggaggagaaggtattgacggggac
cgacacagcgcaacgttgtcaatgggacagccaggtgtgctgcacggcgttaggacatat
atcctgcagtccaaggaaggacaaattattgagacacattcaattagcgctggcctcgat
taccctggcgtaggacctgaacatgcttggctgaaggactcaggaagggcggaatatgtt
gttgccaccgacgaggaagcccttagaggctttagaatgctgacacagcgcgagggcatc
atccctgctctggagtcgtcacacgccatatgggaagccgtgcgtcttgccaaatcccta
ccaaaagatcaggatctcgtggtctgcctctctggccgtggagacaaggacgtcgaacaa
atttctgagcttctccctaagtgggctgacattcttgactggcacgtttctccacacgct
gtttag

DBGET integrated database retrieval system