KEGG   Laccaria bicolor: LACBIDRAFT_187554Help
Entry
LACBIDRAFT_187554 CDS       T01044                                 

Gene name
ACC1
Definition
(RefSeq) ACC1, acetyl-CoA carboxylase, cytosolic
  KO
K11262  acetyl-CoA carboxylase / biotin carboxylase 1 [EC:6.4.1.2 6.3.4.14 2.1.3.15]
Organism
lbc  Laccaria bicolor
Pathway
lbc00061  Fatty acid biosynthesis
lbc00620  Pyruvate metabolism
lbc00640  Propanoate metabolism
lbc01100  Metabolic pathways
lbc01110  Biosynthesis of secondary metabolites
lbc01130  Biosynthesis of antibiotics
lbc01212  Fatty acid metabolism
Module
lbc_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:lbc00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    LACBIDRAFT_187554 (ACC1)
   00640 Propanoate metabolism
    LACBIDRAFT_187554 (ACC1)
  Lipid metabolism
   00061 Fatty acid biosynthesis
    LACBIDRAFT_187554 (ACC1)
  Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    LACBIDRAFT_187554 (ACC1)
Enzymes [BR:lbc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.15  acetyl-CoA carboxytransferase
     LACBIDRAFT_187554 (ACC1)
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     LACBIDRAFT_187554 (ACC1)
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     LACBIDRAFT_187554 (ACC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ACC_central Carboxyl_trans CPSase_L_D2 Biotin_carb_N Biotin_carb_C Biotin_lipoyl ATPgrasp_Ter ATP-grasp_3 Dala_Dala_lig_C Biotin_lipoyl_2 ATP-grasp CARD
Motif
Other DBs
NCBI-GeneID: 6070611
NCBI-ProteinID: XP_001875210
JGI: 187554
UniProt: B0CUD8
AA seq 2213 aa AA seqDB search
MIQGGNSLDKAPASNVYDFVKANGGHTVITKVLIANNGIAAVKEIRSIRQWSYETFGRER
AVEFTVMATPEDLKVNAEYIRMADQYIEVPGGSNNNNYANVDLIVDIAERAGVHAVWAGW
GHASENPRLPESLAASKNKIIFIGPPGSAMRSLGDKISSTIVAQSANVPTMPWSGTGITD
TVLSESGYVTVPDKAYADACVSSVEEGMERAEEIGYPVMIKASEGGGGKGIRKVDHPDGF
KNAYHAASGEIPGSPIFIMKLAGQARHLEVQLLADQYGNAISLFGRDCSVQRRHQKIIEE
APVTIAKEETFEQMERAAVRLSKLVGYVSAGTVEYLYSHADDSFYFLELNPRLQVEHPTT
EMVSGVNLPAAQLQVAMGLPLHRIRDIRQLYGVAPGSSEIDFEMIRPDANQLQRKPRPKG
HVVAVRITAENPDAGFKPSSGSLQELNFRSSTNVWGYFSVSTAGGLHEFADSQFGHIFAY
GEDRSESRKNMIVALKELSIRGDFRTTVEYLIKLLELEAFKENTITTGWLDSLISSKLTA
ERPDATLAVVCGAVTKAYLASDACWTEYKRVLEKGQVPGRDVLKTVFGVDFIYENTRYSF
TAARSSSTVWTLYLNGGRTMVGARPLADGGLLVLLDGRSHSIYWREEVGALRLMVDAKTC
LIEQENDPTQLRSPSPGKLVRFFVDSGDHVNAGDQYAEIEVMKMYMPLIASEDGVIQLIK
QPGVSLEPGDILGILTLDDPARVKHAKPFEGLLPQMGAPGVMGSKPHQTLNRCMGVLNDI
LDGFDNQSIMASTLKELVKVLHDPELPYSEVTAILSSLSGRMPAKLEETIRSAMDIAKAK
GDGHDFPAVRIKKVIDNYIQDHILSQDRAMFRTKIAGLYDVLERYLGGLKGHETETIANL
LSRYEATEKLFGGSIEARVLALRDQHKDDLDKVVGAVLSHIKVQSKVKLVFAVLDYVKTS
GLNVSNTEGRLYQVLQGLASLEAKSSTPVSLKAREVLILGQMPSYEERLHQMETVLKNSV
TDNYYGEQHDSTLSRTPSAEVLKELSDSRYTVFDVLPSFFDHEDPMVRLAALEVYVRRAY
KAYTLLSIDYEEGEVPTAVTWRFNLGRSHSPPSTPRLSGGEPPRRAASVSDLTFMINRHQ
SQPVRIGAIASFPNLPSLSKGFNKVVSMLPVFDKQEFSERYGANNDAPNVVNIALRIFRP
EDDLSEEAWHQKILDFVNKHSSVLTERGVRRISIMLCRMGQYPVYFTLRDFSGIWGEEQA
IRNIEPALAFQLELSRLSNYNLKPCFVEAKQIHIYHAIARENQLDNRFFIRALVRPGRLR
GSMTTAEYLISETDRLVTSVLDALEIVSAEHRNADCNHIFMNFVYNLAVGYEDVLAAISG
FIERHGKRLWRLHVTSSEIRIALEDSDGNVTPIRCTIENVSGFIVNYHGYQEITTDKGTT
ILKSIGDKGPLHLQPVHQAYPTKESLQPKRYQAHLIGTTYVYDFPDLFSKALHNVWIKAR
NTDPSLVLPKSFLESKELVLDEHDRLTEVDRAPGNNNFGMVGWVFTLRTPEFPQGRKVVV
VANDITYKIGSFGPVEDQFFYQVTQYARERGLPRIYLSANSGARLGLAEEVIPLFSTAWK
EQGKPEKGFDYLYLTPENFLKLQEKGANSVRTEEIKDDGERRFKITDIIGLQEGLGVESL
KGSGLIAGETSRAYNDIFTITLVTARSVGIGAYLVRLGERAVQVEGQPIILTGAQALNKV
LGREVYTSNLQLGGTQIMFKNGVSHLTAGSDLQGATHILEWLSYVPEIKNGPLPVRESSD
SWDRDIGYLPPKGAYDPRWFIEGKIDENTSEWTSGFFDKDSFQETLSGWAQTVVVGRARL
GGIPMGVIAVETRTIERLVPADPANPASFEQRIMEAGQVWYPNSAYKTAQAIFDFDREGL
PLIIFANWRGFSGGQQDMYDEVLKQGSKIVDGLSSYKQPVFVYIVPNGELRGGAWVVLDP
SINSEQMEMYADVDARAGVLEPEGIIEIKMRRDKIRSLMERLDSTYASLNRDSKDASKSE
EERSTASTALAARETFLQPTYKQIAILYADLHDRTGRMEAKGCAKPAVWRNARRYFYWAV
RARVARSVALADLAEASPGISFEHRSQLLDDLASIEPGMDYRQMSEALEKLDLTRTLAQL
RADHLMRRLVDLTKQDHKAAMESFLRMADHLSDEDRTSLIGALQGPRSAPLSK
NT seq 6642 nt NT seq  +upstreamnt  +downstreamnt
atgatacaaggtggtaactcattggacaaggcacctgctagcaatgtctacgattttgtc
aaagcaaatgggggtcatactgtaatcaccaaggtcctaattgcaaacaacggtattgct
gccgtgaaagaaattcgttcgattcgccaatggagctacgaaacgttcggcagggaacgc
gccgtggaatttacggttatggcgactcctgaagatctcaaagtgaacgccgaatatatt
cggatggccgaccaatatatcgaagttccaggaggatcaaataacaataactatgcgaat
gtcgatttgatagttgatatcgcggaacgtgctggtgttcacgccgtttgggcaggatgg
ggacacgcttccgagaatcctcgcctcccggaaagtttggctgcaagcaaaaacaagatt
atctttatcgggcctccaggaagcgccatgaggagcctgggtgacaaaatttctagcaca
atcgttgctcagagcgcaaacgtacccacaatgccttggtcaggcacaggaatcacggac
actgtgctttcagaatcaggatatgtgaccgtaccagacaaggcttatgctgatgcctgc
gtgtcgtccgttgaggagggtatggaacgtgccgaagaaattggatatccggtgatgatc
aaagccagcgagggcggaggtggcaagggaatcagaaaagtcgatcacccagatggattt
aaaaatgcgtatcacgcggcctcaggcgaaattccaggctcgcccatctttatcatgaag
cttgctggtcaagcgcgtcatttggaagttcagctcctcgcagatcaatatggaaacgcc
atctctctctttggtcgagactgctcggtgcaacgccggcatcagaaaatcatcgaagaa
gcgccagttacaatcgcgaaagaggagactttcgaacaaatggaacgtgcagcggttcgc
ctctcaaaacttgttggctatgtcagcgcgggaacagtagaatatctttacagtcacgcc
gatgattcgttttactttttagagctcaatcctcgtctccaagttgagcatccgaccacg
gagatggtgtctggtgtcaacctccctgctgcacaactccaggttgctatgggtcttccc
ttgcaccgtattcgtgacattcgtcaactctatggcgtcgctcctggcagctctgaaatc
gactttgaaatgatcaggccggacgccaaccaactgcaacgcaagcctcgtccgaaaggc
catgttgtcgctgtccgaatcactgcggaaaatcccgacgctggtttcaaaccgtcgtct
ggttcattgcaggaactcaatttccgctcaagcaccaatgtctggggctatttctctgtc
agtacagctggtggattacacgagtttgccgattcacagttcggtcatatttttgcctac
ggcgaagatcgcagtgagagccgaaaaaacatgatcgttgctctcaaggagttgagcatt
cgcggagattttagaacaacggtggagtatcttatcaagctcttggagttggaagcattc
aaggagaataccatcacgactggctggcttgattcccttatcagtagcaagcttacggca
gaacgccctgatgcgactctggcggttgtttgcggcgccgttaccaaggcctacttagcg
tcggacgcttgctggacagaatacaagcgtgtccttgaaaagggacaagtgcctggtcgt
gacgttctcaaaaccgtcttcggcgtcgatttcatctacgaaaacactcgttactctttt
accgctgctcgatcttcgtcaacagtttggactctctatctcaacggtggcaggacaatg
gttggtgcaaggccgcttgcggatggcggcctgctcgtgctccttgacggtagaagtcac
tccatctactggcgtgaggaagttggcgccctcagattgatggtcgacgccaaaacctgt
ctgatcgagcaggaaaacgatcccactcaactaaggagcccaagccctggtaagctggtc
cggttctttgttgatagcggagatcatgtcaatgctggagaccagtatgcggaaatagag
gtcatgaaaatgtacatgccacttatcgcctcggaggatggtgtcatccagctaatcaag
cagccgggagtcagcctcgaacctggagacattctcggtatcctcactcttgatgatcca
gcccgtgtcaaacacgcgaagccgtttgagggccttctgcctcagatgggggccccaggt
gttatgggtagtaagccccaccaaacgctcaaccgttgtatgggagttttgaacgacatc
ttggatgggttcgacaatcaatccatcatggcctctacactcaaggagctcgtcaaagtt
ctccatgatcctgaattgccgtactctgaagtgaccgccattctttcgtcactatcaggt
cgtatgcctgccaagttagaggagaccatccgttctgcgatggatattgcgaaggcgaaa
ggcgacggtcatgatttccctgctgttcgcatcaagaaggttattgataactatattcaa
gaccatatattgtctcaagatcgagcgatgttccgcacgaagattgcaggactttatgac
gtcttggagaggtatttgggaggcttgaaaggacatgagacggagactattgccaatctt
ttgtctcgttatgaagcaacggagaaacttttcggtggcagcattgaggctcgtgttttg
gctctccgcgatcagcacaaagatgatctcgacaaggtcgttggtgccgttcttagccac
atcaaggtccagagcaaagtcaaattggtctttgccgtcctggactacgtcaagacaagt
ggactcaatgtctcaaataccgaaggccggctttatcaagtcttgcagggacttgcatcg
ttggaagccaaatcctccacccctgtttcgctcaaggctcgcgaggttctcattcttggt
caaatgccctcctacgaggaacgccttcatcagatggaaactgtcctaaaaaattccgtc
acagacaactattatggcgaacaacacgattcaaccctaagcaggaccccgtctgcggag
gttcttaaagaactcagtgattcgaggtacaccgtcttcgatgtgcttccttccttcttc
gatcacgaagaccctatggttcggctcgctgcccttgaggtttacgttagacgtgcatac
aaggcatataccctactttccatcgactacgaagaaggcgaggtgccgacggccgtaaca
tggcgcttcaaccttggacggtcgcattctcctccatcgactcctcgactttctggcggg
gaacctcctcgtagagcggcttctgtcagcgatcttactttcatgatcaatcgccaccaa
tcgcaacctgtgcgaattggtgcaattgcctcattccctaaccttccttccctctcaaaa
ggctttaacaaggttgtctctatgctacctgtttttgacaaacaggaattctcagagcgg
tatggtgccaacaatgacgcacccaacgtcgttaatattgctcttcgtattttccgccca
gaggacgacttgtccgaggaagcttggcatcagaaaatccttgactttgtcaacaagcac
tccagcgttctcactgaacgtggagtgcggcgcatttccataatgctctgccgcatgggc
caatacccagtctacttcaccctccgcgatttttcgggtatctggggtgaggagcaggca
attcgtaatatagagccagccctggcattccaactggagctaagccgtctttccaactac
aacctaaaaccctgcttcgttgaggccaaacaaattcatatataccacgctattgcgcgg
gagaaccaactcgacaaccgattcttcatccgcgctttggtaaggcctggtcgcttacgc
ggctctatgaccacagcagagtatctcatttccgaaactgatcgcttggtcacaagcgtt
ttggacgctctcgaaatcgtgagtgcagaacaccgaaacgccgactgcaatcatatcttc
atgaacttcgtctacaacctggctgtcggttacgaagacgtcctggccgctatctctggt
tttattgaacgccacggcaagcggctttggcgtctccacgtcacaagctctgaaattcgc
atcgcccttgaggacagcgacggcaacgtcacccccattcgatgcaccattgaaaacgtc
tccggcttcatcgtcaactaccacgggtatcaagaaataaccactgacaaagggacaacg
attctcaaatcaataggcgataaggggcctctgcatttacagcctgtgcaccaagcatac
ccaaccaaggaatcgcttcaaccaaaacggtaccaggcacatctcattggaaccacatat
gtatatgacttccccgatctcttctcaaaagccctgcacaacgtttggatcaaagctcgc
aacaccgacccctcccttgttcttcccaagtccttcttggagtcgaaggaactcgttttg
gatgagcatgatcgattgaccgaagtagacagggcacctggcaacaacaacttcggcatg
gttggatgggtatttaccctcagaaccccagaatttccacaaggtcgcaaagtcgtcgtc
gtcgccaatgacattacctacaagatcggatcttttggacctgttgaagaccaattcttc
tatcaagtaacccaatacgctcgcgaacgcggtctccctcgcatctacctatcagccaac
tccggtgctagacttggtctggcagaagaggttattcccttgttctcaaccgcctggaaa
gagcagggcaagccggaaaagggattcgattatctctatctcaccccagagaatttcctc
aagttgcaggagaagggtgcgaatagcgtccgcactgaagagatcaaggacgatggtgaa
cgtcgtttcaagatcactgacattatcggattgcaagaaggtctcggcgtcgaatctctc
aagggttccggcctcatcgctggtgagacctcacgagcgtacaacgatattttcacaatc
acactcgttaccgcgaggtcggttggaattggcgcctatctcgtacgccttggggagcga
gccgttcaggtcgagggtcagcccatcatccttactggtgcgcaggctctcaacaaagtc
ctcggacgcgaagtctacacatccaatctgcaactcggcggtacccagatcatgttcaag
aacggggtctcccacctcactgcaggcagcgatttacaaggagctactcatattttggaa
tggctttcatacgtaccagaaattaagaatggcccactgcccgttcgagaaagctctgat
tcatgggatcgtgacattggttatctgcctccgaagggcgcatacgatcctcgttggttt
attgaaggaaagatcgacgagaacacatccgagtggacgagtgggtttttcgacaaagac
tctttccaagagacgctcagcggttgggcccaaacggtcgtggtcggacgtgcgcgtctg
ggtggaattcctatgggcgtgattgctgtcgagacccgcactattgaacgattggttcca
gcagacccagcaaatcctgcttcctttgaacagcgaatcatggaggctggtcaggtttgg
tatcctaattcagcgtacaaaaccgcgcaggccattttcgacttcgatcgtgaagggttg
cctttgattatctttgcaaattggcggggattctccggtggacagcaagatatgtatgat
gaggtactgaagcaaggctccaagattgtcgacggtttatcaagctacaagcagccagtt
ttcgtttacattgtacccaacggcgagctccgcggtggcgcatgggttgttctcgaccca
tcaatcaattctgagcagatggagatgtatgccgatgttgacgctcgtgcgggtgtgctt
gagccggagggcattatcgaaatcaagatgcgacgagacaagattcgatctttgatggaa
cgtcttgattcgacgtatgcttcgttgaatcgtgatagcaaggatgcctccaagtctgaa
gaagagcgcagcactgcttcgactgccttggctgcccgagaaactttcctgcaaccgaca
tacaaacaaattgcaatcctgtacgccgatctccatgatcgtaccggtcgcatggaggcg
aaaggttgtgccaagcctgctgtatggagaaatgcccgacgctacttttactgggcggta
cgggctcgtgtcgctcgatcagttgctcttgcagatcttgcagaagccagccccggtatt
tcattcgagcatcgatcccagctcttagacgaccttgcatccatcgaaccaggcatggat
taccggcagatgtcggaggctctcgaaaaattggatcttacccgaactctcgcccaactc
agagccgaccaccttatgcgccggttggtggacttgacgaagcaggatcacaaagcggct
atggaaagcttcctgcgtatggcagaccatctgtcggacgaggacaggacctcactaata
ggtgctcttcaaggacctcgttctgcacccctatcgaaatga

DBGET integrated database retrieval system