KEGG   Laccaria bicolor: LACBIDRAFT_187757Help
Entry
LACBIDRAFT_187757 CDS       T01044                                 

Gene name
GK
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
lbc  Laccaria bicolor
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lbc00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    LACBIDRAFT_187757 (GK)
Enzymes [BR:lbc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     LACBIDRAFT_187757 (GK)
Exosome [BR:lbc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LACBIDRAFT_187757 (GK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 539 aa AA seqDB search
MSHGLKHTELVGSLDCGTTSVRFILFNKYADIVAQHQLEFPQYYPHPGQVWHEHDVEEIQ
QHADICIAEALNSLEASGFSKQSVKVIGITNQRETTVAWSRSTGKPLCKAIVWADSRTKN
TVAHYEQKLGETGIQVSPGIWKKEKEGVEALREITGLPLSTYFSAIKLRWMIDNYPNVFK
AHNADDLCFGTIESWIVYNLLGGPKTNIHISEVSNASRTLLLNTATLKWEQSLVDFFGFR
PSILPKLVSTSEVYGNIAYGPLTGVPIGGLVGDQQGALIGNKCLTRGEAKCTYGTGAFLL
FCTGHDIVKSNHGLLSTIAYQPGPGAKPVYALEGSIAVAGSAVKWLRDQMKIISSAAEIN
SLAAQEPDTGGVYFVTAFSGLLAPYWDPGAAGLLIGISQYTNPSHIARAALEANAFQTRA
IIESMKLDSGSDLKALKVDGGMTNGDVAMKILADIGGFRVIRPEMRESTALGSAICAGAA
IKLFGWDLTKPESLSEVNTKGNVEFTAHRIEEERQKKWEKWQLAVKRSRNWEEGDVSKA
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgtctcatggactcaagcacaccgagctcgtcggctccctcgattgcggcacgacatct
gttcgtttcattctcttcaataaatatgcagacatcgtcgcccagcaccagcttgagttc
ccccaatactatccccatccagggcaggtatggcacgagcatgatgtagaagagatacag
cagcacgcggatatatgcattgcggaagccctcaactctctcgaagcatcaggcttttcg
aagcagagtgtgaaagtcatcggtatcaccaatcaacgcgaaactacggtcgcatggagt
cgaagcacgggaaagccgctttgcaaagccatcgtctgggctgattctaggacgaaaaac
acggtcgctcactatgagcaaaaacttggtgagactgggattcaagtctcgcccggtata
tggaagaaggagaaggagggcgttgaagctcttcgggagataacgggtcttcctctttcc
acctacttctcagctatcaaactgcgatggatgattgacaactaccccaacgtttttaaa
gcacacaatgcagatgatttatgttttggaaccatcgaatcttggattgtatataacctt
cttggtggacccaagactaatattcacatcagcgaagtctccaacgcgtctcgcacattg
cttctcaataccgcgactctcaaatgggagcagtctctcgtcgatttttttggcttccgt
ccatccattctacccaaactcgtttcaacatccgaagtgtatggcaacattgcatatggc
ccattgactggtgtaccgataggtggcctagtcggtgaccagcaaggcgctctcattgga
aacaagtgtcttactcgaggcgaagccaagtgcacttatgggactggtgcattccttctg
ttctgcactggtcacgatattgtgaagagcaaccacggattgctgagcactattgcgtat
caacctggtccaggtgcgaagcctgtatacgcgctggaaggaagtatcgctgttgctggt
agtgcggtcaagtggcttcgggatcaaatgaagatcatcagcagtgctgcagaaatcaac
tccctcgctgcgcaagagcctgatactggcggtgtttacttcgtcacagcgttctcaggg
ctgctggccccatactgggatcccggagcagccggcctcctcataggcatttcacagtat
accaatccctcccacatcgcgcgtgcggcactcgaggctaacgcgttccaaacccgcgcc
atcattgagagcatgaagctcgattctggctctgatctgaaagctctcaaggtcgatgga
gggatgaccaacggcgacgtcgcgatgaaaatcctggccgacattgggggcttcagagtg
atccgccctgagatgagagagtcgactgcgctcggttcagccatctgcgctggagctgct
atcaaactttttggctgggatttgacgaaacccgaatcccttagcgaagtcaacaccaag
ggtaacgttgagtttaccgctcacaggattgaggaagaaaggcagaaaaaatgggaaaaa
tggcaactagccgttaaacgttcaaggaattgggaggaaggtgatgtcagcaaggcatga

DBGET integrated database retrieval system