KEGG   Laccaria bicolor: LACBIDRAFT_187757Help
Entry
LACBIDRAFT_187757 CDS       T01044                                 

Gene name
GK
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
lbc  Laccaria bicolor
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:lbc00561]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 539 aa AA seqDB search
MSHGLKHTELVGSLDCGTTSVRFILFNKYADIVAQHQLEFPQYYPHPGQVWHEHDVEEIQ
QHADICIAEALNSLEASGFSKQSVKVIGITNQRETTVAWSRSTGKPLCKAIVWADSRTKN
TVAHYEQKLGETGIQVSPGIWKKEKEGVEALREITGLPLSTYFSAIKLRWMIDNYPNVFK
AHNADDLCFGTIESWIVYNLLGGPKTNIHISEVSNASRTLLLNTATLKWEQSLVDFFGFR
PSILPKLVSTSEVYGNIAYGPLTGVPIGGLVGDQQGALIGNKCLTRGEAKCTYGTGAFLL
FCTGHDIVKSNHGLLSTIAYQPGPGAKPVYALEGSIAVAGSAVKWLRDQMKIISSAAEIN
SLAAQEPDTGGVYFVTAFSGLLAPYWDPGAAGLLIGISQYTNPSHIARAALEANAFQTRA
IIESMKLDSGSDLKALKVDGGMTNGDVAMKILADIGGFRVIRPEMRESTALGSAICAGAA
IKLFGWDLTKPESLSEVNTKGNVEFTAHRIEEERQKKWEKWQLAVKRSRNWEEGDVSKA
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgtctcatggactcaagcacaccgagctcgtcggctccctcgattgcggcacgacatct
gttcgtttcattctcttcaataaatatgcagacatcgtcgcccagcaccagcttgagttc
ccccaatactatccccatccagggcaggtatggcacgagcatgatgtagaagagatacag
cagcacgcggatatatgcattgcggaagccctcaactctctcgaagcatcaggcttttcg
aagcagagtgtgaaagtcatcggtatcaccaatcaacgcgaaactacggtcgcatggagt
cgaagcacgggaaagccgctttgcaaagccatcgtctgggctgattctaggacgaaaaac
acggtcgctcactatgagcaaaaacttggtgagactgggattcaagtctcgcccggtata
tggaagaaggagaaggagggcgttgaagctcttcgggagataacgggtcttcctctttcc
acctacttctcagctatcaaactgcgatggatgattgacaactaccccaacgtttttaaa
gcacacaatgcagatgatttatgttttggaaccatcgaatcttggattgtatataacctt
cttggtggacccaagactaatattcacatcagcgaagtctccaacgcgtctcgcacattg
cttctcaataccgcgactctcaaatgggagcagtctctcgtcgatttttttggcttccgt
ccatccattctacccaaactcgtttcaacatccgaagtgtatggcaacattgcatatggc
ccattgactggtgtaccgataggtggcctagtcggtgaccagcaaggcgctctcattgga
aacaagtgtcttactcgaggcgaagccaagtgcacttatgggactggtgcattccttctg
ttctgcactggtcacgatattgtgaagagcaaccacggattgctgagcactattgcgtat
caacctggtccaggtgcgaagcctgtatacgcgctggaaggaagtatcgctgttgctggt
agtgcggtcaagtggcttcgggatcaaatgaagatcatcagcagtgctgcagaaatcaac
tccctcgctgcgcaagagcctgatactggcggtgtttacttcgtcacagcgttctcaggg
ctgctggccccatactgggatcccggagcagccggcctcctcataggcatttcacagtat
accaatccctcccacatcgcgcgtgcggcactcgaggctaacgcgttccaaacccgcgcc
atcattgagagcatgaagctcgattctggctctgatctgaaagctctcaaggtcgatgga
gggatgaccaacggcgacgtcgcgatgaaaatcctggccgacattgggggcttcagagtg
atccgccctgagatgagagagtcgactgcgctcggttcagccatctgcgctggagctgct
atcaaactttttggctgggatttgacgaaacccgaatcccttagcgaagtcaacaccaag
ggtaacgttgagtttaccgctcacaggattgaggaagaaaggcagaaaaaatgggaaaaa
tggcaactagccgttaaacgttcaaggaattgggaggaaggtgatgtcagcaaggcatga

DBGET integrated database retrieval system