KEGG   Laccaria bicolor: LACBIDRAFT_189159Help
Entry
LACBIDRAFT_189159 CDS       T01044                                 

Definition
glycogen synthase (EC:2.4.1.11)
Orthology
K00693  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
lbc  Laccaria bicolor
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:lbc00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    LACBIDRAFT_189159
Enzymes [BR:lbc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     LACBIDRAFT_189159
Glycosyltransferases [BR:lbc01003]
 Polysaccharide
  Storage polysaccharide
   LACBIDRAFT_189159
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 731 aa AA seqDB search
MSDDKRDIHNPILFECAWEVANKVGGIYTVIKTKVPVTVSEYGDRYCLIGPLSYKTAPME
VEAEEPKDVHLAATLESMRLQGVKALYGRWLIEGNPHVLLFDTGSMYSKLDEWKGDLWNL
AGIPSPPNDHETNETIVFGYLVAWFLGEYVARQLTIAVVAHFHEWQAGLAIPLCRKRHID
VTTVFTTHATLLGRYLCAGSVDFYNNLQYFDVDHEAGKRGIYHRYCIERSATHCADVFTT
VSHITAYESEHLLKRKPDGVLPNGLNVVKFQAMHEFQNLHSTSKSKINEFVRGHFYGHYD
FDLDNTLYMFTAGRYEYRNKGVDMFIESLARLNYRLQKAGSTVTVVAFIIMPATTHSYTV
EALKGQAVTKQLRDTVTEIQNRVGARLFDHAARFHGSTIPTPDELLSEEDQVLLKRRIFA
LKRNSLPPIVTHNMADDASDPILNQIRRVKLFNNSSDRVKIVFHPDFLNSNNPILGLDYE
EFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSITTNLSGFGCFMQDLIEHPEDEGCYIVD
RRMQSVEDSVNQLTDNMFKFTQKTRRQRINQRNRVERLSPLLDWKNLGIEYSKARQLALR
RAYPDAFYGGDGEEAYGESFGEGMERMKPSSVPASPRLRGMATPGDMGTLTEDMQALNTS
DYRGYNWPGAHEDEEDSYPFPLVMKVRSRSGSVMSGASTPGGGAFKSLSEGDLKKADAAL
SQVNGSGIAAY
NT seq 2196 nt NT seq  +upstreamnt  +downstreamnt
atgtcggacgataaacgcgacatccacaaccccatcctcttcgaatgtgcttgggaggtg
gcgaacaaggttggcggcatctacaccgtcatcaaaacaaaagtacctgttaccgtctcc
gagtatggcgataggtactgccttatcggtcctttgtcctacaagacggcccctatggag
gttgaagcagaggagcctaaagatgttcatctggccgctactctcgaatctatgcggctt
cagggcgtcaaggccttgtacggtcgatggctcattgaaggcaacccccatgtcctgctt
ttcgacaccggcagcatgtattccaagctggatgaatggaagggtgacttgtggaatttg
gctggaatccctagccctccgaatgatcatgaaacaaatgaaaccatcgtctttggttac
ttggttgcgtggtttcttggtgaatacgtggcccgtcaactgaccatcgccgttgtagca
cactttcatgaatggcaagctggcctcgcaatacccctatgtcgaaaacgacacatcgac
gtcaccactgttttcacaacacacgcgaccctccttggtcgatacctttgcgcaggctca
gttgatttttacaataacttacagtattttgacgtggatcacgaggccggtaaacgagga
atttatcatcgttactgcatcgaacggtctgcaacccattgtgcagatgtgttcacgaca
gtctcccacatcaccgcctacgagagtgagcatttgctcaagagaaagccagacggcgtg
cttccaaacggcttgaatgttgtcaaattccaagcgatgcacgagttccagaacttacac
tcaacgagcaaatcaaaaatcaacgaattcgtcaggggtcacttctacggacattatgat
tttgatttagataacactctctacatgttcacggctggacgttatgagtatcggaataaa
ggagtggatatgtttatcgagtctcttgctcggttgaattaccgtctccaaaaggccggt
tctacggtcactgttgttgcgttcatcattatgcccgccaccacccattcctacaccgtt
gaggctctcaaaggccaagccgttaccaaacaattacgagatacagtgaccgagatacaa
aacagagtgggcgctcgattattcgaccacgcagctcgattccacgggtccacgattccc
acacccgacgaattgctttctgaagaagatcaagtgttactaaagcgccgtatatttgcc
ttgaagcgcaattctttaccgcccatcgtgactcataacatggctgacgacgccagcgat
cctattctcaaccaaatccgcagggtgaagctttttaacaatagcagcgatcgtgtcaag
attgtcttccacccagattttttgaatagcaacaaccccattctcggtctggattacgaa
gagtttgttcgcggctgccatctcggtgtgttcccgagttactatgagccatggggatac
actcccgcagaatgcaccgttatgggcatcccgtctatcaccactaacctatctggattt
ggctgcttcatgcaagatcttatcgagcaccctgaagatgaaggctgttatattgtggac
cgacgcatgcaatccgttgaagactccgtcaaccaacttactgataacatgttcaaattc
acgcaaaaaactcgcagacaacgtatcaaccaacggaaccgtgtcgaacgactcagtcca
ttacttgactggaaaaaccttggtatagaatacagcaaggctcgtcaactagctctcagg
cgcgcatatcctgatgcattctacggcggtgatggtgaagaggcgtacggagagagcttc
ggcgagggtatggaaagaatgaaacctagcagtgtacccgcaagtcccaggttgaggggc
atggcgacgcctggagacatgggtacattaacagaagatatgcaggccctcaacacgagc
gattatcggggctacaattggccaggcgcccatgaggacgaggaggattcgtatccattc
cctcttgtgatgaaagtgcgttcgcggtcaggttcggttatgagcggagcgagcacacct
ggcggaggagccttcaagagtctcagtgaaggagacttgaaaaaagcagacgccgcacta
agccaggttaatggcagcgggattgcggcctattga

DBGET integrated database retrieval system