KEGG   Laccaria bicolor: LACBIDRAFT_189547Help
Entry
LACBIDRAFT_189547 CDS       T01044                                 

Definition
hypothetical protein
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
lbc  Laccaria bicolor
Pathway
Meiosis - yeast
Module
cAMP signaling
Brite
KEGG Orthology (KO) [BR:lbc00001]
 Cellular Processes
  Cell growth and death
   04113 Meiosis - yeast
    LACBIDRAFT_189547
Enzymes [BR:lbc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     LACBIDRAFT_189547
Protein kinases [BR:lbc01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   LACBIDRAFT_189547
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 363 aa AA seqDB search
MEVDDAEKVVSPQPPQRLLEDEKVHLQRSGLKLSDFEVRGTLGTGTFGKVLLVRHRSSAA
NPTKQNHFAMKVLRKTEIVRLRQVEHVNAERYILSRVHHPFVVDLFATFQDSLNVYMLMS
YVPGGELFTHLRRAQRFTPDVTRFYLATIILALKYLHSFNVIYRDLKPENLLLDSRGYLR
LTDFGFAKIVDDRTWTLCGTPEYLAPEIIQSDGHGKAADWWACGVLCYEMLVGYPPFFDE
SPYGIYEKILNGQIHWPRSMDRLSRDLIKAFLNPDRTKRLGNMNGGPDDILDHPWFRGVD
WDALERREINAPIIPRTSSIDDTRHFLHLPLPPSEEIPGFTREEQPPALHQRFDPIAYQF
LEF
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atggaagtcgatgatgcagagaaagtcgtgtccccgcagcctcctcagcgactactggaa
gatgaaaaagttcatctacaacggtctggcctcaagctatccgactttgaggttcgtggg
acgctaggtactggcacctttggcaaggttctgctcgtacgccatcgaagctctgctgct
aatccaaccaagcaaaatcactttgccatgaaggtgctgcgcaagacagagattgtccgc
cttcgtcaagttgaacacgtcaacgcagagcgttacattctttcccgagttcatcatccc
ttcgtcgtcgatctctttgccacctttcaagatagcctgaacgtctacatgctaatgtca
tacgttcctggaggagagctctttacccatctacgccgtgcccagcggttcacccccgat
gtcacccgcttctacctcgcaaccatcatcttggctcttaagtatctccactccttcaac
gtgatttaccgcgacctcaaacctgagaacctcctgttggattcccgtggatacctccgc
ctcaccgattttgggttcgccaaaattgtcgacgaccgtacctggacgctgtgcggtact
ccagaatacctcgccccggagataatccagtcagacggccacggaaaagcagcagactgg
tgggcgtgtggcgtcctttgctatgagatgctcgttgggtatccgccgttctttgacgaa
tccccctatggcatatacgagaaaatcctcaatggacaaattcactggccaagaagcatg
gaccgcctgtcgcgtgatttgatcaaggctttcctcaatccagaccgcacaaaacgactt
gggaatatgaacggagggccggatgatatccttgatcacccatggttcagaggtgtggac
tgggacgctttggagcgtcgcgagatcaacgcacccataatccctcgtacttcatccatc
gacgacacgcgtcacttcttgcacctcccgttacccccatcagaagagattcccggtttt
accagagaagagcagccgccagctctccaccaacgtttcgaccccatcgcatatcaattc
ctcgaattttaa

DBGET integrated database retrieval system