KEGG   Laccaria bicolor: LACBIDRAFT_190061Help
Entry
LACBIDRAFT_190061 CDS       T01044                                 

Definition
mitochondrial pyruvate dehydrogenase
Orthology
K00898  
pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
lbc  Laccaria bicolor
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 444 aa AA seqDB search
MSAAFRITPHLWDKIHHFASFPQTGVSLQQMVLFGQNPSQGTLLKASQFLAAEELPVRLA
HRVKELDELPHNLSAMPSIQKVKLWYAQSFEELITFPPIALPPDIRQALMVPRSDDIALP
ESKPNPSFTKFADGSTQYTHGYCNSNGNGFNKLKLRVPMERRYYANTNNISWPPAVQDYN
KRFTKVLEHIKSRHDPTVTTVAQGVLEWKRSQNARHIGLDIQAWLDRFYLSRIGIRFLIG
QHVALNTHQAHEDYVGIICTKANVHDIVQEAIENARFVCEEHYAMFKGPPVQLICPKHLI
FPYVPGHLSHICFELLKNSLRAVVERYGVDDDTGVVYPPIKVIVVEGKEDITIKISDEGG
GIARSAIPLIWTYMYTTMESQDIDQNFKASDFKAPMAGFGYGLPLSRLYARYFGGDLRLI
SMDGFGTDVYIHLNRLSSSQEPLP
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcagcttttcgtataaccccacatctatgggacaagatccaccattttgctagt
tttcctcaaaccggggtttctttgcaacaaatggtcttattcggccaaaatccgagccaa
ggaacgcttttgaaggcgagccaattcttggcagcagaggagctgcctgtgcgtctggcc
catcgtgtcaaggaacttgatgagctgcctcacaacctcagcgccatgccctccatccag
aaggtcaagctctggtatgctcaatccttcgaggaacttatcacctttccgccgatagct
ctgcctccagacattcgccaagctctcatggttccccgttcagacgatattgctctccca
gaatcaaagcccaatccctccttcacaaaattcgccgatggctccactcaatacactcac
ggatattgcaatagcaacggaaatgggtttaacaagttgaagctacgtgtgccaatggag
cgaagatattatgccaatacgaataacatctcatggccaccagcagtacaagattacaac
aaacgcttcacaaaagttttagagcatatcaagagtaggcacgatcccaccgtcactacc
gttgctcaaggtgtcttggaatggaaacgaagccaaaatgcacgccacattggattggac
attcaagcctggctagaccgattctatctctctcgtataggcatccgatttttgattggt
caacacgtcgcactaaacacccaccaagcacacgaagactatgttgggataatctgcaca
aaagcgaatgtacacgatatcgttcaagaagccatcgagaacgcgcgctttgtatgtgaa
gagcactacgccatgttcaaagggcctcctgttcagctcatctgccctaaacacctcata
ttcccttacgtcccgggccacttgtcacacatttgttttgagttgctcaaaaactccttg
cgtgcggttgttgagcgatatggcgttgacgacgatactggtgtggtatatccacccatc
aaagtgatcgttgtggaaggcaaggaagacataaccatcaagatctctgacgagggtggg
ggcattgcacggagtgccatccctctcatttggacatacatgtacacgacgatggagagc
caggacatcgatcaaaatttcaaggctagcgacttcaaagctcctatggctggatttggc
tatggtttgcccctgtcgagattgtatgcccgctattttggaggcgacctccgcctgata
tctatggacggattcggaacggacgtgtatatccatctcaatcggctgtcgagcagccag
gaaccgctaccttag

DBGET integrated database retrieval system