KEGG   Laccaria bicolor: LACBIDRAFT_190082Help
Entry
LACBIDRAFT_190082 CDS       T01044                                 

Definition
(RefSeq) hypothetical protein
  KO
K11843  ubiquitin carboxyl-terminal hydrolase 14 [EC:3.4.19.12]
Organism
lbc  Laccaria bicolor
Brite
Enzymes [BR:lbc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     LACBIDRAFT_190082
Peptidases [BR:lbc01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   LACBIDRAFT_190082
Ubiquitin system [BR:lbc04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    LACBIDRAFT_190082
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UCH UCH_1 ubiquitin Ald_Xan_dh_C2
Motif
Other DBs
NCBI-GeneID: 6075558
NCBI-ProteinID: XP_001879732
JGI: 190082
UniProt: B0D7E9
AA seq 539 aa AA seqDB search
MALIPVHIKHAGKTYDLNLDPDLPPNVFKDAVYNATGVPLDRMKVMVKGGTLKEDSSWKK
IAPKAGQTFMVIGAAGDLPKPPAKPIVFLEDMDDSELAEALAKPVGLRNLGNTCYMNATV
QALRAIPELQVALTAPALHSTTPLPASLRDLYHNMSRTTDSITPIGFLQVLRQVNPQFAE
VDRSGKGGMMGDAEECYQAIINTLRNVPGLDASGSSVAAHERKLVDQYLMGEMRRELTCD
EAPEEPASVSTEQVLKIECNIINTTNFMLTGILNSLDTKVEKNSPTLGRQAIYSQKSRLT
RLPGYLTVHMVRFAWRADIGKKAKIMRKVKFPLEFDALDLATDELKAKLLPVSRKLKEVE
KERMERRKVRKRTKTVPSSSSASTSADAAVVAAGNAATGDVEMADAAAAPASTEVKGGDL
EAEGVYREKEAKELAELVDPSVKSDVGCSATGLYDLVAIVTHKGAAADAGHYIGFVKKSV
GDGNGNPVSSLELGEDDEDWYKFDDEKVSIFPKEKLATLDGGGEDSSAYVLLYRSKSLD
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atggcactgatccccgtacacatcaagcacgcaggaaagacgtacgacctcaacctcgac
cccgatctcccaccaaatgtcttcaaagatgccgtatacaacgctacaggcgttccttta
gatcgtatgaaggtcatggttaagggtggcacactcaaggaggactcttcttggaaaaag
atcgcgcccaaagctggacaaacgttcatggttatcggcgctgctggagacctgccaaaa
ccacctgcaaaacctattgtttttctcgaagacatggacgactcagaattagcagaagca
ttggcaaaacccgtcggcttacgcaatcttgggaatacatgctacatgaatgcgactgtg
caggcccttcgcgccatccctgagcttcaagtcgctctcaccgctcccgccctacactca
actacacctttacccgcctccctgcgcgatttgtaccacaacatgtcgcgtacaacggac
agcatcacgcccataggattcttacaagttctcagacaggtcaacccccaattcgctgaa
gttgaccgtagcgggaaaggagggatgatgggtgatgcggaagaatgttatcaagccata
atcaacactctccgtaacgtcccagggctcgatgcatctggcagcagcgtcgctgcacat
gaacgcaaactggtggaccagtatttgatgggcgagatgcgtcgcgagctgacgtgcgac
gaggccccagaggaaccggcgtcagtgagcaccgaacaggtgttgaaaattgaatgtaat
attatcaatacgaccaactttatgctcacgggaattctgaattcccttgacaccaaagtc
gaaaaaaactcaccgacattgggtagacaagcgatatacagtcaaaaatcacgattgacg
cgcttgcctggctatcttactgtacacatggtgcggttcgcatggagagctgacattgga
aagaaggcgaagatcatgcgtaaagtgaaatttccactcgagtttgacgcgctcgaccta
gctacggacgagcttaaagcaaaattgcttcctgtcagccggaaactcaaggaagtggaa
aaggagaggatggagaggaggaaggtccggaagaggactaaaactgttccctcttcttcg
tccgcttctacttcagctgatgcggctgttgttgcggctggtaatgctgcgacgggcgac
gtggagatggctgacgctgctgctgctcctgcatcgactgaagtgaagggtggtgatttg
gaggcggagggcgtgtatcgggagaaggaagccaaggagctggcggagctcgtagatccg
tctgttaaatctgatgtggggtgcagtgcgactgggttgtatgaccttgttgccatcgta
acacacaaaggcgcagccgccgacgcagggcattacatcggctttgtgaagaagagcgtt
ggcgatggcaacgggaatcccgtgtcctcgctcgagctgggcgaggacgacgaggattgg
tacaagtttgatgatgagaaggtgtcgattttcccgaaggagaagttggcgacgctggat
gggggtggggaggattcgtctgcttatgtgttgctttataggagtaaatcgttggattga

DBGET integrated database retrieval system