KEGG   Laccaria bicolor: LACBIDRAFT_190082Help
Entry
LACBIDRAFT_190082 CDS       T01044                                 

Definition
hypothetical protein
Orthology
K11843  
ubiquitin carboxyl-terminal hydrolase 14 [EC:3.4.19.12]
Organism
lbc  Laccaria bicolor
Brite
Enzymes [BR:lbc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     LACBIDRAFT_190082
Peptidases [BR:lbc01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   LACBIDRAFT_190082
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 539 aa AA seqDB search
MALIPVHIKHAGKTYDLNLDPDLPPNVFKDAVYNATGVPLDRMKVMVKGGTLKEDSSWKK
IAPKAGQTFMVIGAAGDLPKPPAKPIVFLEDMDDSELAEALAKPVGLRNLGNTCYMNATV
QALRAIPELQVALTAPALHSTTPLPASLRDLYHNMSRTTDSITPIGFLQVLRQVNPQFAE
VDRSGKGGMMGDAEECYQAIINTLRNVPGLDASGSSVAAHERKLVDQYLMGEMRRELTCD
EAPEEPASVSTEQVLKIECNIINTTNFMLTGILNSLDTKVEKNSPTLGRQAIYSQKSRLT
RLPGYLTVHMVRFAWRADIGKKAKIMRKVKFPLEFDALDLATDELKAKLLPVSRKLKEVE
KERMERRKVRKRTKTVPSSSSASTSADAAVVAAGNAATGDVEMADAAAAPASTEVKGGDL
EAEGVYREKEAKELAELVDPSVKSDVGCSATGLYDLVAIVTHKGAAADAGHYIGFVKKSV
GDGNGNPVSSLELGEDDEDWYKFDDEKVSIFPKEKLATLDGGGEDSSAYVLLYRSKSLD
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atggcactgatccccgtacacatcaagcacgcaggaaagacgtacgacctcaacctcgac
cccgatctcccaccaaatgtcttcaaagatgccgtatacaacgctacaggcgttccttta
gatcgtatgaaggtcatggttaagggtggcacactcaaggaggactcttcttggaaaaag
atcgcgcccaaagctggacaaacgttcatggttatcggcgctgctggagacctgccaaaa
ccacctgcaaaacctattgtttttctcgaagacatggacgactcagaattagcagaagca
ttggcaaaacccgtcggcttacgcaatcttgggaatacatgctacatgaatgcgactgtg
caggcccttcgcgccatccctgagcttcaagtcgctctcaccgctcccgccctacactca
actacacctttacccgcctccctgcgcgatttgtaccacaacatgtcgcgtacaacggac
agcatcacgcccataggattcttacaagttctcagacaggtcaacccccaattcgctgaa
gttgaccgtagcgggaaaggagggatgatgggtgatgcggaagaatgttatcaagccata
atcaacactctccgtaacgtcccagggctcgatgcatctggcagcagcgtcgctgcacat
gaacgcaaactggtggaccagtatttgatgggcgagatgcgtcgcgagctgacgtgcgac
gaggccccagaggaaccggcgtcagtgagcaccgaacaggtgttgaaaattgaatgtaat
attatcaatacgaccaactttatgctcacgggaattctgaattcccttgacaccaaagtc
gaaaaaaactcaccgacattgggtagacaagcgatatacagtcaaaaatcacgattgacg
cgcttgcctggctatcttactgtacacatggtgcggttcgcatggagagctgacattgga
aagaaggcgaagatcatgcgtaaagtgaaatttccactcgagtttgacgcgctcgaccta
gctacggacgagcttaaagcaaaattgcttcctgtcagccggaaactcaaggaagtggaa
aaggagaggatggagaggaggaaggtccggaagaggactaaaactgttccctcttcttcg
tccgcttctacttcagctgatgcggctgttgttgcggctggtaatgctgcgacgggcgac
gtggagatggctgacgctgctgctgctcctgcatcgactgaagtgaagggtggtgatttg
gaggcggagggcgtgtatcgggagaaggaagccaaggagctggcggagctcgtagatccg
tctgttaaatctgatgtggggtgcagtgcgactgggttgtatgaccttgttgccatcgta
acacacaaaggcgcagccgccgacgcagggcattacatcggctttgtgaagaagagcgtt
ggcgatggcaacgggaatcccgtgtcctcgctcgagctgggcgaggacgacgaggattgg
tacaagtttgatgatgagaaggtgtcgattttcccgaaggagaagttggcgacgctggat
gggggtggggaggattcgtctgcttatgtgttgctttataggagtaaatcgttggattga

DBGET integrated database retrieval system