KEGG   Laccaria bicolor: LACBIDRAFT_190672Help
Entry
LACBIDRAFT_190672 CDS       T01044                                 

Definition
hypothetical protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
lbc  Laccaria bicolor
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:lbc00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    LACBIDRAFT_190672
Enzymes [BR:lbc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     LACBIDRAFT_190672
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 326 aa AA seqDB search
MEQRGCKCTVRGSINHDEYFHVERIVRPGETISSKTHESQVGGKGANQAVAIVRAGGIAY
FYGTVGRDGTWVTDKMKHYGIDVGGIIVSDDPTGRAIIQVAADGENSIESPGYFPETSHL
LLQNEIHPRSMAYALDNARNATIIYNPSPLPSDQELSRFPWNKIDWLIVNEAEAAGICRS
LNRSRANTTANMSTRELVFLLSAHPSFATTNIICTLGGDGVLAFIPTFHRPKTAHEAPSF
MHLQAAKLQGEIRDTTGAGDCFTGYFVQGLMEFGPYAKVGKTIREQEIARILKMSVYAAG
MCVEKMGTIESIPTRAQVEARMSASP
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atggagcagcgaggctgtaaatgcactgtgcgaggttcaatcaaccacgacgagtacttt
catgttgaaaggatcgtaagacctggagagacgatatcttcaaagacgcacgaaagccag
gtgggcgggaagggagcaaaccaggccgtagccatcgtcagagctggaggaattgcttac
ttctatggaacggtcggcagagatggaacttgggtaacggataaaatgaagcactatggg
atagatgtcggaggaatcatcgtttcagacgatcctacgggccgtgccattatccaagtt
gccgcagacggagaaaatagtatcgaatctccaggttatttcccagagacgagccatctc
ctccttcaaaacgaaatacatccccgatcgatggcgtatgcgcttgacaatgcaaggaac
gcgaccattatttacaacccttctcccctaccttctgatcaggagctcagccgctttccc
tggaataaaatcgactggttaattgtaaacgaggcggaggctgcaggtatatgtcgatct
ctgaacagatcgagggcaaacacaacagcaaacatgtcgacgcgcgaacttgtcttccta
ctgtcggctcatccctcgtttgcaaccaccaacatcatttgcacccttggtggggatggt
gtccttgcttttattcctacctttcatcgtccgaagactgctcacgaggcgccgtccttc
atgcatctccaagcggctaaactgcaaggagaaatccgagatacgactggggcaggggat
tgctttacaggttatttcgtgcaaggtctgatggagtttggtccgtacgcaaaggtgggg
aaaactattcgtgaacaagaaatcgctaggattctgaaaatgagtgtttatgctgcgggg
atgtgtgttgagaaaatgggaacgattgaaagtataccaacacgggcccaggtagaagct
cggatgtccgcctctccttag

DBGET integrated database retrieval system