KEGG   Laccaria bicolor: LACBIDRAFT_190858Help
Entry
LACBIDRAFT_190858 CDS       T01044                                 

Definition
hypothetical protein
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
lbc  Laccaria bicolor
Pathway
Purine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lbc00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    LACBIDRAFT_190858
  Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    LACBIDRAFT_190858
Enzymes [BR:lbc01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.3  With oxygen as acceptor
    1.7.3.3  factor-independent urate hydroxylase
     LACBIDRAFT_190858
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 317 aa AA seqDB search
MPNKPLSSLTAARYGKAKVRVFRIVRQDKWHHIVEYNVEALLEGDLESSYTEADNSVVRV
FTSLIRVIRRYLAKISPYILNPEKFALHLGTFFVSKYAHIHKAFVTIEQLRWARIPVEKG
NLKEHPHAFYRDGDDKRVVKVEVDASKGKDKLVGRVSAGISDLLVLKSTGSKFEGFIRDE
YTTLVEVDDRIFSTSVDLEYTFSEIALKAPGDAGKLQFVAPEQEVPERARRATLEVFAED
ESASVQATLYKMAQRIIAENVHIQTVTYTLPNKHYIPVDMKYIGVDNLTPYLSKAEVFTP
VAAPSGLISATISRKQG
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgcccaataaacctctctcatctctcacagccgcgcgatacggcaaggccaaagtacgc
gtcttccgtatcgtaagacaagataaatggcaccatatcgttgaatacaacgtcgaggcg
ttgttggagggcgatctcgaatctagctataccgaagctgataactctgtcgtccgagtc
tttacctcattaatacgcgtcattcgccgctacctagcgaaaatctcaccatacatcctc
aaccccgagaaattcgcactccatctaggaacgttcttcgtctccaaatacgcacacatt
cacaaggcattcgtgaccatcgagcagctccgatgggctcggattcccgttgagaagggg
aacttgaaggaacacccacatgcgttttatcgagatggtgatgataagagggttgtcaag
gtcgaggttgatgcgtcgaaggggaaagataagttggtggggagggttagtgcagggatt
agtgatttgttagtcctgaaatctaccggatccaaattcgaaggcttcatccgggacgaa
tacacaacccttgtcgaggtggacgaccgcattttctcgacttctgtggatctggagtat
acgttttctgagatcgcgttgaaggcgcctggggatgcggggaagctgcagtttgtggct
cctgaacaggaggtgccggagagggctaggagggcgactttggaggttttcgcggaggat
gagagtgctagtgttcaggcaaccctctacaagatggcccagaggataatcgcagagaac
gttcatattcaaactgtgacgtatacccttccgaacaagcactacatccccgtcgatatg
aaatacatcggggtagacaatctgactccttatttgtcgaaagcggaagtttttacgccg
gttgctgcacccagtgggttgatctccgccaccatctctcgcaaacaggggtaa

DBGET integrated database retrieval system