KEGG   Laccaria bicolor: LACBIDRAFT_191321Help
Entry
LACBIDRAFT_191321 CDS       T01044                                 

Definition
glycosyltransferase family 4 protein
Orthology
K03857  
phosphatidylinositol glycan, class A [EC:2.4.1.198]
Organism
lbc  Laccaria bicolor
Pathway
Glycosylphosphatidylinositol(GPI)-anchor biosynthesis
Metabolic pathways
Module
GPI-anchor biosynthesis, core oligosaccharide
Brite
KEGG Orthology (KO) [BR:lbc00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00563 Glycosylphosphatidylinositol(GPI)-anchor biosynthesis
    LACBIDRAFT_191321
Enzymes [BR:lbc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.198  phosphatidylinositol N-acetylglucosaminyltransferase
     LACBIDRAFT_191321
Glycosyltransferases [BR:lbc01003]
 GPI-anchor biosynthesis
  Core oligosaccharide
   LACBIDRAFT_191321
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 470 aa AA seqDB search
METLSIAMISDFFHPAVGGVENHIYMLSANLLRKGHKVIVITHSHPQGRVGIRWLLPCLK
VYYIPFLPIASSATLPNFFTSLPYLRTILLREHIHLIHAHASLSSIGHEGILHSHLMGIR
TVFTDHSLFGFDDAASILTNKLMVGTLKNVDAVICVSHTGRENTVLRGQLFDRDSEDPSK
LVVRSNIYVIPNAIVAEHFKPCPQPPSDTITIVVLSRLAYRKGIDLLVATAPRICALFPN
VNFVVGGDGPKLIDLLQMREKHLLQDRIELLGPVRPGDVLSVLSRGSIFMNTSLTESFGI
AILEAACAGLYVVSTRVGGVPEILPEDMISFAEPEEDDVVRAISEAIFIVSQGKHDPLQA
HERMKTFYDWDQVTARTEVVYHTVMRSKQIELWERMQSTMALGPFAGPIYTIILIVDCIF
FLFLEWWFPREDLDFVHDHWDPKVFAEVGLLFSRSSFTGDFICFCVARKR
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atggaaacactatctattgcgatgatatcggacttcttccacccagcggtgggaggagtc
gaaaaccatatctacatgctcagtgcaaatttacttcgtaaaggccacaaggtaatagta
ataacccacagccacccccaaggacgcgttggcatccgctggctcctcccctgcctcaaa
gtctactacatcccctttctccctattgcctcctcggcaacgcttccaaacttcttcacc
tcccttccttatttgcgcacaattcttcttcgggaacatatccatctcatccacgcgcac
gcaagtttgtcgtctataggccatgaagggatcctgcactcccatttgatgggtatccga
acagtgttcacagaccacagcttgttcggcttcgacgacgctgcgagtatattgacaaat
aagcttatggtgggcacgttgaagaatgtagacgccgtgatctgcgtttctcatactgga
cgagaaaacacggtccttcgcggtcaactatttgacagggactcagaagacccatcaaag
ctcgtcgtgaggtcgaacatctacgtcattcctaatgccattgttgcagaacacttcaaa
ccctgcccccaaccaccttcggataccataaccattgttgttctctcccgtctcgcgtac
cgcaaaggcattgacctccttgtcgccaccgcaccccgaatctgcgctttattcccaaat
gtgaattttgttgttggcggagacggccccaaactaatcgacctcctccaaatgcgcgaa
aagcacctccttcaagaccgtatagagctccttggtccagttcgtccaggggacgtcctt
tccgttttatcacgcggctcgatatttatgaatacctctctgacggaatcattcggaatc
gccatcttagaagcagcatgtgcggggctttatgttgtttctacgcgtgtgggcggtgtg
ccagagatattgccagaggatatgatcagtttcgcggagccagaggaagatgacgtcgtc
cgtgccatctctgaagctatattcatcgtcagtcaagggaaacatgaccccctccaggcc
catgagcggatgaagacgttctacgactgggaccaggtcacggcacgcacggaggtcgta
tatcacactgtcatgcgatccaagcaaatagagctttgggagaggatgcagagcacgatg
gcgctaggcccattcgcaggaccgatttacaccatcatcctcatcgtggattgcattttt
ttcttgttcctcgagtggtggttccctagggaagatctggatttcgtgcatgatcactgg
gatccgaaggtattcgcagaggtgggtcttctgttttctcgttcaagttttacgggtgac
ttcatctgtttttgcgtagctcgtaaaagatga

DBGET integrated database retrieval system