KEGG   Laccaria bicolor: LACBIDRAFT_192602Help
Entry
LACBIDRAFT_192602 CDS       T01044                                 

Definition
(RefSeq) profilin
  KO
K05759  
profilin
Organism
lbc  Laccaria bicolor
Brite
Membrane trafficking [BR:lbc04131]
 Others
  Actin-binding proteins
   Others
    LACBIDRAFT_192602
Cytoskeleton proteins [BR:lbc04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Profilin
     LACBIDRAFT_192602
Exosome [BR:lbc04147]
 Exosomal proteins
  Proteins found in most exosomes
   LACBIDRAFT_192602
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 126 aa AA seqDB search
MSWQAYVDSNLIGSGKVSKAAIIGLKGGVWATSVGFTLSTEEQKAIVDGFKNPDAILASG
VRLGGQKFFAVRADQRSIYGKKQLDGAVIVKTTQAVIVTEYLAPLQAPETTPIVEGLADY
LISVGY
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgtcttggcaagcatacgtcgattctaacctgatcgggagtggcaaggtctcaaaggcg
gcgattattggtttgaagggtggtgtatgggcaacgtcggtggggttcacattaagcaca
gaggaacagaaggcgatcgttgacggtttcaagaaccctgacgctattctggcaagcggt
gttcggcttggaggtcaaaagttcttcgcggtccgagccgaccagcgtagtatttacggg
aagaagcagctcgacggcgctgtgatcgtcaagaccacacaggctgtcattgtcactgaa
tacctggcgccactccaagccccggagacgacgcccattgtggagggtcttgcggattat
ctgatctctgtgggctactag

DBGET integrated database retrieval system