KEGG   Laccaria bicolor: LACBIDRAFT_227877Help
Entry
LACBIDRAFT_227877 CDS       T01044                                 

Definition
hypothetical protein
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
lbc  Laccaria bicolor
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lbc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    LACBIDRAFT_227877
   00670 One carbon pool by folate
    LACBIDRAFT_227877
Enzymes [BR:lbc01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     LACBIDRAFT_227877
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 201 aa AA seqDB search
MLRLTIIVAATKSNGIGFNSRLPWRLRKEIKYFAQVTTTAPSGQQNAVIMGRNTWESLPQ
KFRPLPNRLNVVISRNLAYDLCEFAARVNEHDLKSALSRVENPTSASSSSPIHRAFIIGG
ASLYSEALGLSTDVVDHILLTRIVSPDFEQCDVFMPDFLSGKGGWKRVNHAVLEEWVGFE
VVEGVQEEDGVKYEFQMWVRD
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgttacgtcttaccatcatcgttgctgccaccaaatcgaatgggatcggcttcaactcg
cgtctaccatggcgactgcgaaaagagatcaagtactttgcgcaagttacaactactgca
ccatctggccagcaaaatgctgtaattatgggtaggaacacatgggaaagtctcccacaa
aagttccgaccactccccaaccgcctcaacgtcgttatcagccgtaatctggcctacgat
ttgtgcgaatttgctgcacgtgtcaatgagcatgacctcaaatctgcactgtcacgagta
gagaatccaacctcggcctcgtcgtcgtcacccatacacagagctttcatcattggcggc
gcgtcattatattcagaagcgcttggtctatcaacagacgttgttgatcacatcttactc
acgcgtattgtctctccggactttgagcaatgtgatgtattcatgcccgactttctgtcg
ggtaagggggggtggaaacgtgtgaatcacgctgtgttggaggagtgggtcgggtttgaa
gtggtagagggtgtgcaagaggaggatggtgtgaaatacgagtttcagatgtgggtgcgg
gattaa

DBGET integrated database retrieval system