KEGG   Laccaria bicolor: LACBIDRAFT_229065Help
Entry
LACBIDRAFT_229065 CDS       T01044                                 

Definition
hypothetical protein
Orthology
K03259  
translation initiation factor 4E
Organism
lbc  Laccaria bicolor
Pathway
RNA transport
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:lbc00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    LACBIDRAFT_229065
Translation factors [BR:lbc03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    LACBIDRAFT_229065
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 181 aa AA seqDB search
MEDIKRVISFDSVEEFWGLYNNIIPPSQLPQKANYYLFKEGIIPAWEDEANKNGGKWSIQ
LPKDKNRPNVDKMWLYTMLAAIGETFDPSPTDSENGSQSLITGVIVSTRPQFYRLSIWTR
LAPGADEDGLRERIEGVGKYFKISVLGYPEGAKLAGPLATEVEFLSHKDSEKKGKPKKIV
V
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atggaggacatcaagcgtgtcatcagcttcgatagtgtcgaggaattctggggcttgtac
aataacattataccaccgtctcaattgccgcaaaaggctaactactatctgttcaaggag
gggattattcccgcatgggaagacgaggcgaacaagaatggagggaaatggagcattcaa
ttgcctaaagacaaaaatcgtcccaacgttgacaagatgtggctgtataccatgcttgct
gcaataggcgaaacgtttgatccgtcacccacagattcggagaatgggtcgcagtcattg
attacgggggtgatcgtgtctacgcgtccgcagttttatcgactgtcgatatggacgcgc
cttgcacctggtgccgacgaagatgggttacgggagagaattgagggggttggaaaatac
ttcaaaatcagtgtattgggataccccgagggcgcgaagcttgctgggccactggcgacg
gaggtcgagttcctgtcgcacaaggactcggagaaaaagggcaagccaaagaagattgtt
gtttga

DBGET integrated database retrieval system