KEGG   Laccaria bicolor: LACBIDRAFT_230208Help
Entry
LACBIDRAFT_230208 CDS       T01044                                 

Definition
hypothetical protein
Orthology
K08866  
serine/threonine-protein kinase TTK/MPS1 [EC:2.7.12.1]
Organism
lbc  Laccaria bicolor
Pathway
Cell cycle - yeast
Class
Cellular Processes; Cell growth and death; Cell cycle - yeast [PATH:lbc04111]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 280 aa AA seqDB search
VNKKAYARLDMIGKGGSSRVFRVLNHANELYAIKRVSLDKTDSETMSGYMNEIALLKRLE
GNSRIIRLIDSEVKAGPGGSKGHLLLVMECGEIDLARLLQEQMKEPVNMVWVSYYWQQML
QAVHVIHEEKIVHSDLKPANFVLVRGQLKLIDFGIANAIANDTTNIQRDHQIGTVNYMSP
EAIELPDGMRRLKVGRPSDVWSLGCILYQMIYGHPPFQHLSVYQKMKAIPDSAHVIEFPE
LDVIAGIKSCLCRNPKERATIPELLDQDWLALKERELPAR
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
gtgaacaaaaaggcgtacgctcgactcgatatgatcgggaaaggcggttcctcccgcgtt
ttccgtgtgcttaatcatgcaaacgagctatacgctatcaaacgggtatcgctcgacaag
acagactcggagacgatgagtggctacatgaacgaaattgctttgctcaaacggctcgaa
gggaatagtcgaatcattcgcctgatcgacagcgaggtgaaggctggaccaggagggagc
aaaggacatttgcttcttgtaatggaatgcggggaaattgacctagcaaggttgctccag
gagcagatgaaggaacctgtgaacatggtttgggtttcctattattggcaacagatgctg
caagccgtgcatgtcattcacgaagaaaagattgtgcattctgacttaaagccggcaaat
tttgtcttagtgcgtggtcagcttaagctgatcgattttgggatcgcaaatgccatcgcc
aacgacacgacgaacatccagagggatcatcagattggtactgtgaattacatgagccca
gaagccatcgaacttccagatggtatgcgacggcttaaagttggtcgaccgtccgacgtc
tggtcactaggttgcattctataccagatgatctatggacatccaccgtttcagcatctt
tcggtgtaccaaaagatgaaagccatcccggactcggcacatgttattgagttcccagag
ttggacgtgattgcgggtatcaagagctgcttgtgccggaatccgaaagagcgggcaaca
attccagagttgcttgaccaagattggctagctttgaaagaacgtgagttgcctgctcgt
tga

DBGET integrated database retrieval system