KEGG   Laccaria bicolor: LACBIDRAFT_232153Help
Entry
LACBIDRAFT_232153 CDS       T01044                                 

Definition
hypothetical protein
Orthology
K04464  
mitogen-activated protein kinase 7 [EC:2.7.11.24]
Organism
lbc  Laccaria bicolor
Pathway
MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:lbc00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    LACBIDRAFT_232153
Enzymes [BR:lbc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     LACBIDRAFT_232153
Protein kinases [BR:lbc01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   LACBIDRAFT_232153
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 376 aa AA seqDB search
MQRHSFTALNSTFVVDAEYQFVKELGQGAYGCVVSARHRRSGEGCAIKKITNINTKRILT
KRCLREIRLLHHFRGHKNITCLYDMDIVFQPNGNFDEVYLYEELMEADLHAIIRSGQPLT
DAHFQSFLYQTLCGLKYIHSANVLHRDLKPGNLLVNADCELKICDFGLARGYTPGGGTSK
AAGNQGFMTEYVATRWYRAPEIMLSFANYSTAIDVWSVGCILAELLGGKPIYKGRDYVDQ
LNQILHYLGTPSEDTLRRVGSPRAQDYIRSLPIKPRVPFSTLFPHANPLAIDLLSQMLCF
DPAKRISCEQALNHPYLQVWHDPADEPVCDTKFDFGFEEEDSIDGMKKLIIEEVNSFRAE
VRAQARAAGQIRRQDR
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgcaacgacatagttttaccgcgctcaactctacattcgttgtcgatgcagagtaccag
ttcgtcaaggagctgggccaaggtgcatatggctgcgtcgtctccgctagacatcgacgc
tcaggcgaagggtgcgctatcaagaagatcacaaacatcaacaccaagcgcatcttgact
aagcgctgcctaagagagatcaggttattgcaccacttccggggtcacaaaaacattaca
tgcctttacgacatggatattgtatttcaaccaaacgggaactttgatgaggtttatctc
tacgaggaactgatggaagctgacctccacgcaatcattcgatcaggccaaccgctgacc
gacgctcacttccaatcctttttgtatcaaactctttgcggcctcaagtatattcactca
gcaaatgtactccatcgcgatctcaaaccagggaatcttcttgtaaatgctgattgcgag
cttaaaatatgtgactttggtttggctcgtggctatactcctggcgggggaacttccaag
gcagccggaaatcaaggtttcatgacggaatacgttgccacccgttggtaccgtgcgccc
gaaatcatgctgagcttcgcaaactactctaccgccatcgatgtttggtctgttggatgc
atcctagctgaactgcttggtggaaagcccatctataagggtagagactacgttgaccag
ttgaatcagattcttcattatttgggcactccatctgaagatactctccgccgtgttgga
tcacctcgggcccaagactacatcaggtctctgccaattaaaccccgtgttcctttctca
acccttttccctcatgcaaatcctcttgctatcgatctcctttcccagatgctttgcttt
gaccccgctaagcgcattagctgcgagcaagccttaaatcatccatatctacaagtctgg
catgatcccgccgatgaacctgtatgcgacactaaattcgacttcggattcgaagaggaa
gacagcattgatgggatgaagaagctaattatcgaagaagtcaactcattccgagcagaa
gtgcgcgcgcaggccagggctgcgggtcagattcgccgtcaagacaggtaa

DBGET integrated database retrieval system