KEGG   Laccaria bicolor: LACBIDRAFT_232153Help
Entry
LACBIDRAFT_232153 CDS       T01044                                 

Definition
(RefSeq) hypothetical protein
Organism
lbc  Laccaria bicolor
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
JGI: 
UniProt: 
AA seq 376 aa AA seqDB search
MQRHSFTALNSTFVVDAEYQFVKELGQGAYGCVVSARHRRSGEGCAIKKITNINTKRILT
KRCLREIRLLHHFRGHKNITCLYDMDIVFQPNGNFDEVYLYEELMEADLHAIIRSGQPLT
DAHFQSFLYQTLCGLKYIHSANVLHRDLKPGNLLVNADCELKICDFGLARGYTPGGGTSK
AAGNQGFMTEYVATRWYRAPEIMLSFANYSTAIDVWSVGCILAELLGGKPIYKGRDYVDQ
LNQILHYLGTPSEDTLRRVGSPRAQDYIRSLPIKPRVPFSTLFPHANPLAIDLLSQMLCF
DPAKRISCEQALNHPYLQVWHDPADEPVCDTKFDFGFEEEDSIDGMKKLIIEEVNSFRAE
VRAQARAAGQIRRQDR
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgcaacgacatagttttaccgcgctcaactctacattcgttgtcgatgcagagtaccag
ttcgtcaaggagctgggccaaggtgcatatggctgcgtcgtctccgctagacatcgacgc
tcaggcgaagggtgcgctatcaagaagatcacaaacatcaacaccaagcgcatcttgact
aagcgctgcctaagagagatcaggttattgcaccacttccggggtcacaaaaacattaca
tgcctttacgacatggatattgtatttcaaccaaacgggaactttgatgaggtttatctc
tacgaggaactgatggaagctgacctccacgcaatcattcgatcaggccaaccgctgacc
gacgctcacttccaatcctttttgtatcaaactctttgcggcctcaagtatattcactca
gcaaatgtactccatcgcgatctcaaaccagggaatcttcttgtaaatgctgattgcgag
cttaaaatatgtgactttggtttggctcgtggctatactcctggcgggggaacttccaag
gcagccggaaatcaaggtttcatgacggaatacgttgccacccgttggtaccgtgcgccc
gaaatcatgctgagcttcgcaaactactctaccgccatcgatgtttggtctgttggatgc
atcctagctgaactgcttggtggaaagcccatctataagggtagagactacgttgaccag
ttgaatcagattcttcattatttgggcactccatctgaagatactctccgccgtgttgga
tcacctcgggcccaagactacatcaggtctctgccaattaaaccccgtgttcctttctca
acccttttccctcatgcaaatcctcttgctatcgatctcctttcccagatgctttgcttt
gaccccgctaagcgcattagctgcgagcaagccttaaatcatccatatctacaagtctgg
catgatcccgccgatgaacctgtatgcgacactaaattcgacttcggattcgaagaggaa
gacagcattgatgggatgaagaagctaattatcgaagaagtcaactcattccgagcagaa
gtgcgcgcgcaggccagggctgcgggtcagattcgccgtcaagacaggtaa

DBGET integrated database retrieval system