KEGG   Laccaria bicolor: LACBIDRAFT_234621Help
Entry
LACBIDRAFT_234621 CDS       T01044                                 

Gene name
ECH-3
Definition
enoyl-CoA hydratase
Orthology
K07511  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
lbc  Laccaria bicolor
Pathway
Fatty acid elongation
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Fatty acid metabolism
Module
Malonate semialdehyde pathway, propanoyl-CoA => Acetyl-CoA
Brite
KEGG Orthology (KO) [BR:lbc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LACBIDRAFT_234621 (ECH-3)
   01212 Fatty acid metabolism
    LACBIDRAFT_234621 (ECH-3)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    LACBIDRAFT_234621 (ECH-3)
   00650 Butanoate metabolism
    LACBIDRAFT_234621 (ECH-3)
  Lipid metabolism
   00062 Fatty acid elongation
    LACBIDRAFT_234621 (ECH-3)
   00071 Fatty acid degradation
    LACBIDRAFT_234621 (ECH-3)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LACBIDRAFT_234621 (ECH-3)
   00310 Lysine degradation
    LACBIDRAFT_234621 (ECH-3)
   00380 Tryptophan metabolism
    LACBIDRAFT_234621 (ECH-3)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    LACBIDRAFT_234621 (ECH-3)
Enzymes [BR:lbc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     LACBIDRAFT_234621 (ECH-3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 285 aa AA seqDB search
MAFRSVLKPRLNFSPVRLMSTSQRQYNFILVSRPEPSVVLVTLNRPKALNALSSPLFQEL
NQALEEADKDDTVGAMVLTGSEKAFAAGADIKEMKDKQCKFSNVFKNKFLENWGEIASLR
KPVIAAVSGFALGGGCELALMCDIILASPTAKFGQPEINLGVIPGGGGSQRLAQVIGKSR
TMEMVLTGRMVSAQEAANWGIVSRVVADGEGEVVKEAVAMAKDIASKSQIAVQAGKEVVN
AAYELNLAEGLRLERRLFHGLFATNDQKEGMSAFSEKRKPNFTHT
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atggcttttcgctccgttttaaagccacgattgaacttttctccagtccgcctcatgtcc
acctcgcaacgacaatataatttcatccttgtttcgcgtccagagccttccgtcgttctt
gttaccctcaacaggcccaaagcattgaacgctttgagcagccctctattccaagagttg
aaccaagctctcgaggaagcagacaaagatgacacggttggcgcgatggttctaaccggc
tccgagaaagcctttgcagctggtgccgatatcaaagaaatgaaggataaacagtgcaag
ttttctaacgtgttcaagaacaagtttttggaaaattggggagaaattgcaagcctccgt
aagccagtgatagcggccgtcagtgggtttgcgctggggggtggctgcgaattagccttg
atgtgtgacattatcctggcctctccaaccgccaaatttggccagcctgaaatcaacctg
ggtgttatccctggtggaggcggttcccaaaggctcgcgcaggttattggaaaatctcgg
accatggaaatggttttgacagggcgtatggtctctgcgcaagaagccgcaaattgggga
atcgttagcagggttgttgcagacggtgaaggtgaggtcgtcaaggaggcggtggcaatg
gcgaaagatatcgcgagcaagagtcaaattgctgttcaggctggcaaagaagttgtgaac
gctgcttacgagctgaatcttgccgaaggcttgaggttagagagacggcttttccacggt
ttattcgcaaccaatgaccaaaaggagggcatgtctgcgttctcagagaagcgaaagcca
aacttcactcacacttag

DBGET integrated database retrieval system