KEGG   Laccaria bicolor: LACBIDRAFT_236346Help
Entry
LACBIDRAFT_236346 CDS       T01044                                 

Definition
glycosyltransferase family 39 protein
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
lbc  Laccaria bicolor
Pathway
Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:lbc00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    LACBIDRAFT_236346
Enzymes [BR:lbc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose-protein mannosyltransferase
     LACBIDRAFT_236346
Glycosyltransferases [BR:lbc01003]
 O-Glycan biosynthesis
  O-linked Man type (Man a1- Ser/Thr)
   LACBIDRAFT_236346
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 683 aa AA seqDB search
IYTLLSCYTRFHKIGASNIVVWDEAHFGKFGSHYLKREFYFDVHPPLGKMLVGLAGLLSG
YDGGFEFKSGEVYPEGVPYVAMRVMLATFGVGMVPLAWYTALELGMSLWACHLTAMMVLF
DVGWLCISRFILLDSMLLFFTFLTVFCLTKFHNQQYQSFSVDWWLWLFLTGFSIGCVTSV
KMIGLFVTALVGVYTIEDLWEKFGDTKMPVRDQLKHWGARIACLIVVPILVFMASFKIHF
MVLNHSGPGDAQMSSLFQANLVGNDFAKNPLEIAYGSKLTLKNMGWGGGLLHSHVQSYPV
GSTQQQVTCYHYKDSNNDFVVLPRWDEPPYNPNDPIRFLKDGDVIRLNHAATTRNLHSHT
VLAPVTKLNYEVSCYGNETIGDNHDYWQVEVVDDIKQGPKESVDRIHSLTTRLRFKHQAL
GCYLRAANAILPQWGFKQVEVSCDKENNPKDVHTYWNVESHWNDRLPAGDTKFYRSPFLR
DFWHLNVAMMTSNNALIPDPDKEDILASKPFDWPFLHLGLRMCGWGDTQLKYYLMGTPII
WWASSISLFVGLFALGIYLLRWQRKYHDMDAHEWDHFLYVGKIAFFGWVFHYVPFLIMGR
VTYLHHYLPTLYFAVLMLAHVLDHFIFSSKLLTTKVKNIFFGVFAFLLLFSFWWFKGVAF
GIDGPIADTKGLQWRSSWNIYND
NT seq 2052 nt NT seq  +upstreamnt  +downstreamnt
atctacaccctcctctcctgctacacccgcttccacaaaatcggcgcatccaacatcgtc
gtctgggacgaagcccatttcggtaaattcgggtcccactacctaaaacgggagttctac
tttgacgtgcaccccccgttggggaagatgctcgtgggtcttgcggggctgctttcgggg
tatgatggtgggtttgagtttaagagtggggaagtgtatccggagggtgtgccgtatgtt
gctatgagggttatgttggctacgtttggggtggggatggtgccgcttgcttggtatact
gcgcttgagttgggcatgagtttgtgggcttgtcatttgactgctatgatggttcttttt
gatgtcggctggctttgtatttctcggtttatcctcctggactctatgcttctgttcttc
acgttccttaccgttttttgcttgaccaagttccataatcaacagtaccaatccttttct
gttgattggtggctctggttattcctcaccggcttttccatcggctgcgtaaccagcgtc
aaaatgattggtctattcgtcacggctctcgtgggcgtctacacaatcgaagatctatgg
gaaaagtttggagacaccaaaatgccagtgcgagaccaactaaaacattggggtgcacgc
atagcttgcctcatcgtcgtccccatcctcgtcttcatggcttccttcaaaatccatttc
atggtcttgaaccactcaggcccaggtgacgcgcaaatgagctcgctcttccaagccaac
ctcgtcggaaacgactttgccaaaaacccacttgaaatcgcctacggctcaaaactaacc
ctcaaaaacatgggctggggcggtggcctcctccactctcacgtgcaatcctatccggtg
gggtccacccaacaacaagtgacctgctatcactacaaagactccaacaacgactttgtc
gttctcccccgctgggacgagcctccttacaaccccaacgaccccatccggttcctcaaa
gacggggacgtcatccgtctaaaccacgccgccaccacgcggaatctccactcccacacg
gtcctcgcgcccgttacgaagctgaactacgaagtgtcgtgttacgggaacgaaacgatc
ggggataatcatgattattggcaggtggaggttgtggatgatatcaagcaaggaccgaag
gagagtgtggatcggatacactctttgacgacgcgcttgaggtttaagcatcaggcgttg
gggtgttatctccgcgctgcgaatgcgattttgccgcagtgggggttcaagcaggtggag
gttagttgtgataaggagaataaccccaaggacgtgcatacgtattggaatgtggagagt
cattggaatgatcggttaccagcaggcgacaccaaattctaccgctcccccttccttcgg
gacttttggcacctcaatgtagcgatgatgacgtccaacaacgcgctcatcccagatccg
gataaggaggatatattggcgtcgaagccgtttgactggcccttcttacaccttggactg
aggatgtgtggctggggcgacacgcagctcaagtattacctcatgggcacgcctattata
tggtgggcgagctcgataagtttgtttgtcggtttgttcgcgttgggtatttatttgttg
aggtggcagaggaagtatcatgatatggatgctcatgaatgggaccatttcctgtacgtt
gggaagattgcgttctttggttgggtgttccattatgtgcctttcctcatcatgggtcgc
gtcacctatctgcaccactatctcccaaccctctacttcgcagtcctaatgctcgcccac
gtgctcgaccacttcatcttctcatcgaagctcctcactacaaaagtcaagaacatcttc
tttggcgtgtttgcttttctgttgcttttctcgttttggtggttcaagggcgtggcgttt
gggattgatgggcctattgcggacactaagggattgcagtggcgaagttcgtggaatatc
tataacgattga

DBGET integrated database retrieval system