KEGG   Laccaria bicolor: LACBIDRAFT_242724Help
Entry
LACBIDRAFT_242724 CDS       T01044                                 

Definition
hypothetical protein
Orthology
K07204  
regulatory associated protein of mTOR
Organism
lbc  Laccaria bicolor
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 1213 aa AA seqDB search
YWSAKRHLTCGNPTPGPSWSQKPIPWRGSAPGKLKTATAALVLCLNIDVDPPDIIKTNPC
ANLECWVDPHTLPAQKALEAIGNNLQHQFEGLSLKIGYKYILDPSVEDLRRFCQTLRKQA
KDDAVLFYYNGHGVPKPTASGELWCFNRNYTQYIPVSLQELQAWVGSPGVYIWDCSAAGH
LLQNFNMFAERKDNEVNMMQGGYSNGAQPMINSLQLAACGANEQLPSCPELPADVFTSCL
TSPIDIALRYFIMNHQLPNNITADMVLQLPGDLKDRRTPLGELNWIFTAITDTIAWTTFS
RDIFTKLYRCDLLIASLFRNFLLAERIMKNYHCTPHTFPPLPPTNTHPLWATWDLAVDTC
LRQLPDLLSRSACNPYVYVPSKFFADQLTAFEVWISRGGSALTRQNHLVPRKPPDQLPIV
LQVLLSQPHRLRALILLSQFVDLGPWAVHLVLTIGIFPYISKLLQAQGQDLRPVLIFIWA
RILAVDPTVQTDLFNTQGFKYFANVLGLRNEDVLPNSSEHKAMCSFILAAVCRDFYQGQT
ACCDERVFDNCYERLDEADFLLRQWTALCIAQMWDTNDEMKVYGVDRGTQDKLTELLSDD
SAEVRSAALYALGTFLGASGAIDATKQGGGGSGMEVAVATGATLAIKDDASPMCRKELLV
LISCLVKEWRGYFVVCAWIYWEEDRKWRASTSGHHHSPLHDEDVTNQANRVLLSSFFTIF
VVLLDLSVDPYQEVAANAQTIVDYIMALLLESPFTRLEGTSLNNPPTAPADRHASPQLGT
ASHSPPSPITGDRPGLTRSDTMTSTISSGVSNTLRRTSSFANALKSLANGIAFPSSSDDG
RASPIVSTHVHFQPEVTDISRPPSPNLNVAQYTSPYSRPTTPQGGSHDMQSQNVIDFLPC
DYFKEPQMRQSESDEPGSIQYNYQVWRQQRNERICEQTDSQACAAEKGRWDKTVATFQVQ
GYPLTMAFHSYDQHLVIANESDMISVWDWLAKKRLNYFCNGNPRGTSITSLDIINQDVGG
LILTGSADGIVRMYRNYDPTLEQGPLQMVSAFRGLNEVVQLRQGTGMIMDWKQSAGILLV
GGDSRVIKVWDAQTETQGLDLETNSDSPVTSITSDPGSSQTFIASFADGTLKVFDRRLED
DEAIVRSYSDHTSWVQNVRYHPKLSGRFLSASVDGQVKLWDLRGSDSPTQSWHIHQQGLS
TFDVHPHSSVFAA
NT seq 3642 nt NT seq  +upstreamnt  +downstreamnt
tattggtccgctaaacgacatctcacctgcggcaacccaacaccaggtccatcatggtcg
caaaagcctattccatggcgtggttccgcgccgggaaaactcaaaactgccactgccgcc
cttgtgctttgccttaacatcgacgtagacccacccgacataatcaaaaccaatccctgt
gcgaatctggagtgttgggtggaccctcataccttgccagcccagaaggcacttgaggcg
attggcaacaatttgcaacaccagtttgaaggactcagcctcaagattggctacaaatac
atcttggatccatctgtagaagatcttcgtcgattttgtcaaactctacgaaagcaagca
aaagatgatgcagttttattttactacaatggccacggcgtccccaaaccgacagcgagc
ggggaattatggtgtttcaacaggaattacacgcaatacattcctgtgtcactgcaagag
cttcaggcttgggtagggtctcctggagtttacatctgggattgttctgctgctggccat
cttttgcagaatttcaacatgtttgctgagcgaaaggacaacgaagtcaacatgatgcag
gggggatattctaatggcgctcagcccatgatcaattcgctccaactggcagcgtgtggt
gcaaacgaacaacttccttcatgcccagaattaccggcagacgtttttacatcctgtctc
acctcacccattgatatcgcactcagatatttcatcatgaatcaccagctccccaataac
ataactgctgatatggtcctccaacttccaggcgatctcaaagaccgacgcacacctctg
ggggaactcaattggatatttaccgcaatcactgataccattgcatggactacattttct
cgtgatatcttcaccaaactttatcgatgcgacttactgatcgcctcccttttccgaaac
ttcctccttgctgaaagaatcatgaagaactatcactgcacgccgcacaccttccctcct
cttcccccaaccaacacacatccactttgggcaacgtgggatttggcggtagatacgtgc
ttgcgacaattaccggatctcttatccaggagcgcctgtaacccctatgtctacgtccct
agcaaattcttcgctgatcaactcaccgcattcgaagtttggatctccagaggcggctcg
gctctaaccagacaaaaccatctcgtaccacgtaaaccgccagaccagctccctattgtc
ctccaggttcttctctcccagccgcacagactgagagccctcatcctcttatcccaattc
gttgatctaggaccatgggcagtgcatctagtgctcacgatcggtatattcccctacatc
tcaaagctgctccaggctcaaggccaggatttacgcccagtgttgatattcatttgggca
aggattctcgcggtggacccgacggtgcaaacagacttgttcaacacgcagggtttcaag
tactttgccaatgtgcttgggcttaggaacgaagatgtcctgccgaacagttcagagcac
aaagcgatgtgttcattcatactcgcagcagtgtgtcgtgatttttaccagggacagacc
gcttgttgcgatgagcgggtgttcgacaactgttacgagagattggacgaggctgacttt
ttgttgaggcagtggactgcgttgtgcattgctcagatgtgggacacgaacgatgagatg
aaggtgtatggagtggaccgagggactcaagataaattgaccgaactgctttcggatgac
tctgcagaagtgcgatctgctgcgctctacgcccttggaacgtttttgggtgctagtggg
gctatagacgcaaccaagcagggtggtggaggctcgggaatggaggtggctgtcgctact
ggtgccacgcttgccatcaaggacgacgcgagtcccatgtgcagaaaggaattactcgtt
ctcatcagctgcttagtgaaagagtggcggggttacttcgtcgtctgcgcttggatctat
tgggaagaagatcggaagtggagagcttccacgagtgggcatcatcattcgcctttacat
gacgaagacgttacgaatcaagctaatcgtgtccttttatcatcattcttcaccatcttt
gtggtgcttttggatttgtctgtcgatccatatcaagaagtcgccgcaaatgcgcaaact
attgtcgactatatcatggcactcctccttgaatcacccttcacgcgcttggagggaaca
tcattgaataaccctcctacggcgcctgctgatcgacacgcatctcctcagcttggcaca
gcgagtcattcacccccctcacccattactggggatcgacccggtctcactcgaagtgac
accatgacaagcaccatatctagtggcgtatcaaacacccttcgtcgaacctcatccttt
gccaacgccttgaaatcgttggcgaacggcatcgccttcccatcttcatcggacgacgga
cgagcatcacctatcgtttccactcatgttcatttccagcccgaagtgacagacatctca
cgtccgccttcacccaatctcaacgtagcacaatacacgtcgccttactcacggcccacc
actccacagggaggctcgcacgatatgcaaagccaaaatgtgatagatttcttgccctgc
gattatttcaaggagcctcaaatgagacaatctgagagtgacgagcctggaagcattcaa
tacaactaccaagtctggagacaacagaggaacgagcggatttgcgaacagacagactcg
caggcttgtgcagcggagaaaggcagatgggataaaacagtggcgactttccaagtacag
gggtaccccttgaccatggctttccactcctatgatcagcaccttgtcatcgcaaatgag
agcgacatgatcagtgtctgggattggctagcaaagaagcgtctcaactacttttgcaat
ggcaaccccagaggtacgagcatcacgtcactcgacatcatcaaccaggacgtaggtggt
ctcattttaactggatctgctgatggcatcgtacgtatgtaccggaattatgatccaact
ttggaacagggacctttacaaatggtcagcgccttccgaggtctgaatgaagtcgtccag
ttacgacaaggcactggcatgatcatggattggaagcagtcggcaggtatcttactcgtg
ggaggcgattcccgggtcatcaaggtttgggatgcacaaactgagactcaaggcctagac
ctcgaaactaactcagacagtcctgtcacatccataacttcggaccctggctcttctcaa
acgttcattgcgagttttgctgatggcaccctcaaggtgtttgaccgtcgacttgaagat
gatgaggctatagtgaggtcctattctgatcacacatcttgggtgcaaaacgtacggtac
catccgaagttaagtggaaggttcctgtctgcaagcgtggatggccaggtgaaactctgg
gatctacgaggctctgattctcccacgcaatcgtggcacattcatcaacaaggactctcc
actttcgacgtccaccctcattcgagcgtctttgccgcgtaa

DBGET integrated database retrieval system