KEGG   Laccaria bicolor: LACBIDRAFT_243220Help
Entry
LACBIDRAFT_243220 CDS       T01044                                 

Definition
hypothetical protein
Orthology
K14676  
lysophospholipid hydrolase [EC:3.1.1.5]
Organism
lbc  Laccaria bicolor
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:lbc00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    LACBIDRAFT_243220
Enzymes [BR:lbc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     LACBIDRAFT_243220
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 1444 aa AA seqDB search
MDSEVLTESIDRHPLVSLVSASFWVILWLLSWAKSLVAFATITVPRLLYAVLSYSMTLTL
GFWNFAVFFGVSAVALNYWIRFRYLNDYTQLKEPPLVKPDINELHPDVNTDPPSSFHNYL
DDFLQAVRVFGFLEKPVFHELARHLQTRRLIAGDSLSLSQDKSFYCVVEGMVQVYAQTGH
SPEVQQSLWDDEDMNGYQLLNEVGSGGTLSSLFTILSLFTEDVQMSWQDEYPGVSVDDTA
CFESNPSPFIRNRSHRANSDVSQFDLESKTKTSTRRFSVSSTASTVHADHSRSSRGNSMS
PGHQDEPPVEQMRPFIPSGPSRPTPAHRGVVARATVDTTLAVIPAEAFRRLTKKFPKATG
HIVQVILTRFSRVTFNAAHKYLGLTSEVLRTEKAINDIACHPLPASFYEGGGLQYLRNRF
DASTSSTTETDSDYFSYTQSPSQTTSELPKLKKPSTAAGDDTLQTRKISNGQSPPMRASR
TMVQPGDLLMPKSSIHDSFRTPLRTFSTLNTPGLPRGSDDADLGRKMNQGSRSSHWSVED
FDLREEVMSCIAKSIGLLQPPLSGSDSVEASPAFPATEHRRPSGGFSSPFGSLSLLDLGD
DVSSATGGSSSILPSGNHLSGLDNEVEILFFAAGSTLAKVGELNTGLFYVIEGFLDILLP
SDEGHKDGAAAPTRPDAMPDSVDSEPWRTPGGRSSKPEKKLLFTVKPGGIAGYLASLCNT
ASYVDIQAKTDTYVGFLPLLALERILEKRPIVLLTLAKRLISMLSPLVLHIDASLDWMQV
NAGQVLWRPHDVSDSFYIVINGRLRAISESEKGGVTIEGEFGQGDTVGELDVITSSPRRN
TVHAIRDTELIRMPQTLFNAISARNPQTTAQLLRMIASRVRDEVDSTSLAQGRTSTAELG
HNNTNLKTVAVLPVSRNVPVDAFARKLQSALEGIGASTSYLNQAIISHHLGRHAFTRMGK
LKSAGWLADQEQRFHTVLYVADSPVNSSWTQTCIRQADCVMVVGMGDDPSIGEYERLLLS
MKTTARKELVLLHPDRSVVPGSTREWLKNRPWVHQHIHVEMEGLVLPPKSTVHKDPDAVT
ALKNLKDKVQSEIQKYRGGTTDLRPPRLPHTNDFSRLARRICGRSIGLVLGGGGARGIAH
IGLIRALEEFEIPIDHIAGTSIGAFIGGLYAREGDLLRTVGRAKQFSGRMGNIWRILSDV
TYPIVAYTTASAEIFEITGHEFNRSLYKAFYDLHIEDMWLPYFCNTTNIMTSRMEIHETG
YAWRFIRASMTLVGLLPPLCDNGSLLVDGGYIDNLPVAAMFSMGASAVFASDVGSLDDNS
PRNFGDTVSGWWLLINRWNPFSNARHVPPITEIQSRLAYVSSVKTLEEAKVAKNCLYIQM
PVHEYGTLQFGKFEEIQKQGYIASMDILEKFDKEGRLPSAFMNGIGGINPGGKKKGRSVR
RNSI
NT seq 4335 nt NT seq  +upstreamnt  +downstreamnt
atggattcagaagttcttaccgaatccatcgacaggcatcctttggtttcgttagtgtcg
gcaagtttttgggtcatcttatggcttttgtcgtgggcgaaatccctcgtcgcatttgcg
acgattactgttcctcgactgctgtatgcagtgctctcatattccatgactctaactctc
ggtttctggaacttcgctgttttcttcggggtctcggctgttgctctaaactattggata
cgctttcgttacctcaacgactacacccagttgaaagagcctcctctagtcaaaccagat
atcaacgagcttcacccagatgtcaatacggatccaccctcgtctttccacaactaccta
gacgatttcctgcaggctgtacgagttttcggtttccttgaaaaacctgtgtttcacgaa
ctcgctagacacttgcagacgcggaggctcattgcgggggacagcctttctttgagccaa
gacaaaagcttctattgtgtcgtagaaggcatggttcaagtttatgcccagaccggtcac
tccccagaggttcagcagagtttgtgggacgatgaggatatgaatggctatcaacttttg
aacgaagtgggaagcgggggaacactatcaagtctcttcacaatcctgagcctttttact
gaggatgtgcagatgagctggcaggacgagtaccctggcgtttcggttgacgatactgca
tgctttgaaagcaacccttccccattcatccgcaaccggtcacatagagcgaattctgat
gtttcgcagttcgatctggaatcgaagacgaaaactagcactcgccgattttcggtgtcg
tcgacggcgtcgacagtgcatgcagaccattccaggtcatctcgaggtaattccatgtct
cctgggcaccaagatgaacccccagttgagcaaatgcgtccatttataccctctggcccc
tctcgcccgactcctgctcatagaggggtggtcgcccgggcaacagtggatacgactctt
gctgtgatccctgcagaagctttccgcaggctgacaaaaaagttccccaaagccactggc
catatcgtgcaagtcatcctgacacgattctctcgagttactttcaacgccgctcacaag
tacctgggtctgacaagcgaggtccttcgaacggagaaggctattaatgatattgcctgc
caccctcttccggcttcgttttatgaaggagggggcctccaataccttcgcaaccgtttc
gatgcttccacttcgagtactacagaaaccgatagcgactatttcagttacacccagtca
ccatcgcagacgacatctgaattgcctaaactgaagaaaccatcaactgcagcgggggac
gatactcttcaaactcgtaaaatttccaacggtcaatctccaccgatgcgagcctcgcgt
actatggtgcaacctggtgatcttttaatgccgaaaagcagcattcatgacagctttcga
acgcccttaagaacattcagcacccttaatacaccagggctcccaagaggatctgatgat
gcagatcttggccgcaaaatgaaccagggatcacggtcgtcgcactggtcagtagaagac
tttgatcttcgagaggaggtcatgtcatgcatcgcgaagtctattgggcttctccaacct
cctctcagcggcagtgattctgttgaagcgtcccctgcttttcctgctacagaacatcgt
cgtccctcgggtggttttagctctccctttggttccctttccctccttgatctgggtgat
gacgtatcaagcgcaacaggaggatcctcatcgatattaccttcaggaaatcatcttagt
ggactcgataatgaggttgagattctcttttttgcggcgggttcgactttagcaaaggtc
ggagagttgaatacggggctcttctacgttatcgaaggctttctcgatattctcctgcca
tcagacgagggacataaggatggagccgctgctcctactcgccccgatgcaatgccagac
tcagtcgattccgaaccttggaggactccgggtggtaggagctcgaaacccgaaaaaaag
ctgctattcacagtcaaacctggagggattgccggatatcttgcgtcgctttgcaacaca
gcatcatacgtcgacatccaggcgaagacggacacttacgttggctttttacccctcctt
gcgttggaaagaatactcgagaagcgtccaatcgttctgctcaccctggcaaagcgtctc
atctcaatgctttctcctctagtccttcacattgatgcttctttggactggatgcaagtt
aacgctggtcaagtactctggcggccacatgacgtcagcgacagcttctacatcgtcatt
aacggacgtttgagagccatatcagaatctgaaaagggtggggtgaccattgaaggagag
tttggtcaaggtgatacagtcggggaacttgacgttattaccagttcacccagaaggaac
accgttcatgctatccgcgacactgagctcattcggatgcctcaaaccctcttcaacgca
atttcggcacgcaacccacaaactactgcacaactgctccgaatgattgcttcgcgggtg
cgcgatgaagtagactcaacatctttagcccaagggaggacatcaacggcagaactcggc
cataacaacacaaatttgaagacagtcgccgttcttccggtgtctcgcaacgttcctgtt
gatgccttcgcccgcaagttgcagagtgcactcgaagggataggagcttcaacatcatac
cttaaccaagcgattatttctcatcatctcgggcgccatgcgtttactcggatggggaag
ctcaagtctgcgggttggctggccgatcaagagcaacggtttcacaccgttttgtatgtc
gcagattcgccagttaatagttcctggacccagacttgcatcagacaggctgattgtgtt
atggtggttggtatgggggatgatccaagcattggagaatatgaacgtctgctcttatct
atgaagacaacagcccgtaaggagcttgtcctgttacatcctgatcgctccgtggttcct
ggttcaacccgcgagtggctcaagaatcggccgtgggttcatcagcatatacatgtcgaa
atggagggcttggtgttgccaccgaaatctactgttcataaggatccggacgcagttacg
gcgctgaaaaacttaaaagataaagttcaaagcgaaattcagaagtaccgtggagggaca
acagaccttcgacctccacgcctaccacacacgaacgatttctcccgtttggcaaggagg
atatgcggaagatcgattggccttgtcttgggagggggcggagctagggggatcgcacat
atcggtcttattcgtgctcttgaagagtttgaaatcccgatagatcacattgctggcaca
agcattggcgccttcatcggtggtctgtacgcgcgcgagggagacttgctcaggacagta
ggtcgagccaagcagttcagcggaagaatgggtaatatctggagaattctctctgatgta
acctatccaatcgttgcttacacaacggcgagtgcagaaatttttgaaataacgggacat
gaattcaatcgatctttgtacaaagcattctacgacttacatatcgaagatatgtggcta
ccttacttctgcaatacgaccaacatcatgacatctcggatggaaattcatgaaacagga
tatgcatggaggttcatccgtgcctctatgacattagtgggacttttgccgccactgtgc
gacaatggcagtctgttggttgatggtggatacattgataatctgccagtggcagctatg
ttctccatgggtgctagcgcggtgtttgcttctgacgtgggctcgctcgatgataactct
ccgagaaattttggagatacagtttctggctggtggcttctcatcaatcgctggaacccc
ttctctaatgcccgtcacgtgccgccaattactgaaatacaaagtcgcctggcgtatgtt
tccagtgtcaaaactcttgaagaggcgaaggtagccaagaattgcctctatattcagatg
ccagtccacgagtatggaactttacagttcgggaaatttgaagagatccaaaaacagggc
tacatcgcttcaatggacattcttgagaagttcgacaaggaaggaagacttccctcagca
ttcatgaatgggataggaggaataaaccctggaggaaagaagaaagggaggagtgtccgg
cgtaattcaatttag

DBGET integrated database retrieval system