KEGG   Laccaria bicolor: LACBIDRAFT_243698Help
Entry
LACBIDRAFT_243698 CDS       T01044                                 

Definition
hypothetical protein
Orthology
K11842  
ubiquitin carboxyl-terminal hydrolase 12/46 [EC:3.1.2.15]
Organism
lbc  Laccaria bicolor
Brite
Enzymes [BR:lbc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     LACBIDRAFT_243698
Peptidases [BR:lbc01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   LACBIDRAFT_243698
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 368 aa AA seqDB search
MARSKWISFVGQQALDRAAAAADSRPKVPPSPTVSSADAKKFGLENFGNTCYANSVLQAL
YFCTPFRDLPAVTLPYAPIPPIPSSPPTLFSALRSLFLYISSHPKERGTVSPRAFIDKVK
ELNELFRGTMHQDTHEFLMFLLNRIVEEIEEERKELLNGGAKEEDRTSPQDATLVHKLFE
GVLTSETRCLTCETVSSRDESFLDLSIDIEQNSSVTACLRQFSASEMLCQKNKFFCDACC
DLQEAEKRMKIKKLPNVLALHLKRFKYQEDVGRYIKLAYRVAFPMDLRLFNTVDDMDDSD
RLYNLFAVVVHIGNGPHHGHYISIIKTHGSWLVFDDDNVSTIPESDIPKYFGDSNSGSAY
VLYYQAAD
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atggccaggtcaaaatggatctcattcgttggtcaacaagctctggatcgagcagcagcc
gcagcggactcgaggcccaaagtaccaccctcacccaccgtatcctctgcggatgcgaag
aagtttggcttggagaatttcggtaatacctgctatgcaaactcggtcctacaagctcta
tacttctgcactccttttcgcgatctcccggcggttaccctaccatacgcaccaataccc
cccataccctcatcaccccctaccctcttctccgctctacgatccttatttctctacatc
tcatcccatccgaaagagaggggaacggtctctccccgcgccttcatagacaaggtcaag
gaactcaatgagctctttcgggggaccatgcatcaagatacacacgaatttcttatgttt
ctgctcaatagaatagtggaggaaatagaagaggaacggaaggagttgctgaacggcgga
gcaaaggaagaagatcgaacaagcccacaagacgctactcttgtgcataagctgttcgaa
ggcgtgctaacaagtgaaactcgatgtttgacctgcgaaacagtttcttcacgtgacgag
tctttcttggacctatccatcgatatagagcaaaactcgagtgtcaccgcgtgcctccga
caatttagcgcgagcgagatgctgtgtcagaaaaacaagtttttttgtgatgcgtgttgt
gacttgcaggaggcggagaaacgcatgaaaataaaaaaactaccaaatgttttggctctt
catctaaaaaggttcaaataccaagaagacgtagggaggtacatcaagttggcttatcgc
gtcgcttttcccatggatctccggctgtttaatacggtcgacgacatggacgactcggac
cgactgtataacctttttgccgtcgtagttcatattggaaacggacctcaccacggccat
tatatatctatcatcaagactcatggaagttggcttgttttcgacgatgataatgtatca
acaataccagaaagcgatatcccaaaatatttcggcgactctaactctggatccgcgtac
gtcttgtactatcaggctgctgac

DBGET integrated database retrieval system