KEGG   Laccaria bicolor: LACBIDRAFT_244180Help
Entry
LACBIDRAFT_244180 CDS       T01044                                 

Definition
(RefSeq) hypothetical protein
  KO
K03259  translation initiation factor 4E
Organism
lbc  Laccaria bicolor
Pathway
lbc03013  RNA transport
Module
lbc_M00428  eIF4F complex
Brite
KEGG Orthology (KO) [BR:lbc00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    LACBIDRAFT_244180
Messenger RNA biogenesis [BR:lbc03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     LACBIDRAFT_244180
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     LACBIDRAFT_244180
Translation factors [BR:lbc03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    LACBIDRAFT_244180
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IF4E
Motif
Other DBs
NCBI-GeneID: 6070295
NCBI-ProteinID: XP_001875190
JGI: 244180
UniProt: B0CUA2
AA seq 114 aa AA seqDB search
VESFWSLSTHLAPPSALQPTTDYLLFHSGIRRPVWEDPLNLSGGKWIIRLKKGVADRIWE
DLVLAVIGDQFDGYANRAEWPEICGCTISVRQSEDIVSLWNRVDGDVKVREKIR
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
gtcgagtctttctggtcactgtcgacccacctcgctcccccctcggccctgcaacccaca
accgactaccttctcttccactcgggcatccgccggcccgtatgggaagacccgctcaat
ctctcagggggaaaatggattatcagactaaagaaaggtgttgccgaccgtatttgggaa
gacctcgtcctcgctgttatcggggaccagttcgacggatatgcgaatcgggcagagtgg
cctgaaatttgcgggtgtacgattagtgtgaggcagagcgaggatattgtgagtttgtgg
aacagggtcgatggggatgtcaaggtcagagagaagatcaggtga

DBGET integrated database retrieval system