KEGG   Laccaria bicolor: LACBIDRAFT_244225Help
Entry
LACBIDRAFT_244225 CDS       T01044                                 

Definition
hypothetical protein
Orthology
K10739  
replication factor A2
Organism
lbc  Laccaria bicolor
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Module
RPA complex
Brite
KEGG Orthology (KO) [BR:lbc00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    LACBIDRAFT_244225
   03420 Nucleotide excision repair
    LACBIDRAFT_244225
   03430 Mismatch repair
    LACBIDRAFT_244225
   03440 Homologous recombination
    LACBIDRAFT_244225
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 225 aa AA seqDB search
HSLRPLTIAQLNKATQAHTDAEWQVDGMEIGQVTIVGHVSSIQAQTTNCVYVIDDGTGRI
EARHWSVFFPRLPFQSINEVREKTYVRVTGGLKTFGSKRYINTTHVRPSKDPHEVYFHIL
EAITVTLTLERGPVSPRGADSTMANYTNLSAPIGDEYSHRPKLEQDICRFIAEQPANDAG
IHVAAIARAVGGGGDAHRISDALDKLMDDGLVFTTIDDSHFNLSR
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
cactcattgcggcccttgacaatagcccaattaaacaaagcgacccaggctcatacggac
gcagaatggcaggtggatggcatggaaataggtcaggtaacaatcgttggccatgtatct
tcaattcaagctcaaactacaaattgtgtctacgtaatcgacgacgggacaggacgtata
gaagcacgtcattggtcagttttctttcctcgccttccctttcaatcgattaacgaagtc
agggagaaaacgtatgtccgagtaacgggagggttaaagacatttggcagcaagcgttac
atcaatacaactcatgtccgaccttcaaaagaccctcacgaagtgtactttcacatccta
gaggccattactgttactttgaccctcgaacgcggaccagtgagtccgagaggcgcagat
tcaacgatggcaaactatacaaacctatccgcccctatcggtgacgaatactctcatcgt
ccgaaattggaacaggatatctgtcgatttatcgctgaacaacccgctaatgatgcggga
attcatgttgcggccattgcccgagccgttggcggaggtggtgatgcgcataggattagc
gatgctcttgacaagttgatggacgatggactggtattcaccacgattgatgactcccac
ttcaatctgtctcgttga

DBGET integrated database retrieval system