KEGG   Laccaria bicolor: LACBIDRAFT_244225Help
Entry
LACBIDRAFT_244225 CDS       T01044                                 

Definition
(RefSeq) hypothetical protein
  KO
K10739  replication factor A2
Organism
lbc  Laccaria bicolor
Pathway
lbc03030  DNA replication
lbc03420  Nucleotide excision repair
lbc03430  Mismatch repair
lbc03440  Homologous recombination
Module
lbc_M00288  RPA complex
Brite
KEGG Orthology (KO) [BR:lbc00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    LACBIDRAFT_244225
   03420 Nucleotide excision repair
    LACBIDRAFT_244225
   03430 Mismatch repair
    LACBIDRAFT_244225
   03440 Homologous recombination
    LACBIDRAFT_244225
DNA replication proteins [BR:lbc03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    LACBIDRAFT_244225
DNA repair and recombination proteins [BR:lbc03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     LACBIDRAFT_244225
   MMR (mismatch exicision repair)
     LACBIDRAFT_244225
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     LACBIDRAFT_244225
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RPA_C tRNA_anti-codon RMI2
Motif
Other DBs
NCBI-GeneID: 6070971
NCBI-ProteinID: XP_001875419
JGI: 244225
UniProt: B0CSK7
AA seq 225 aa AA seqDB search
HSLRPLTIAQLNKATQAHTDAEWQVDGMEIGQVTIVGHVSSIQAQTTNCVYVIDDGTGRI
EARHWSVFFPRLPFQSINEVREKTYVRVTGGLKTFGSKRYINTTHVRPSKDPHEVYFHIL
EAITVTLTLERGPVSPRGADSTMANYTNLSAPIGDEYSHRPKLEQDICRFIAEQPANDAG
IHVAAIARAVGGGGDAHRISDALDKLMDDGLVFTTIDDSHFNLSR
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
cactcattgcggcccttgacaatagcccaattaaacaaagcgacccaggctcatacggac
gcagaatggcaggtggatggcatggaaataggtcaggtaacaatcgttggccatgtatct
tcaattcaagctcaaactacaaattgtgtctacgtaatcgacgacgggacaggacgtata
gaagcacgtcattggtcagttttctttcctcgccttccctttcaatcgattaacgaagtc
agggagaaaacgtatgtccgagtaacgggagggttaaagacatttggcagcaagcgttac
atcaatacaactcatgtccgaccttcaaaagaccctcacgaagtgtactttcacatccta
gaggccattactgttactttgaccctcgaacgcggaccagtgagtccgagaggcgcagat
tcaacgatggcaaactatacaaacctatccgcccctatcggtgacgaatactctcatcgt
ccgaaattggaacaggatatctgtcgatttatcgctgaacaacccgctaatgatgcggga
attcatgttgcggccattgcccgagccgttggcggaggtggtgatgcgcataggattagc
gatgctcttgacaagttgatggacgatggactggtattcaccacgattgatgactcccac
ttcaatctgtctcgttga

DBGET integrated database retrieval system