KEGG   Laccaria bicolor: LACBIDRAFT_245379Help
Entry
LACBIDRAFT_245379 CDS       T01044                                 

Definition
carbohydrate esterase family 8 protein
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
lbc  Laccaria bicolor
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lbc00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    LACBIDRAFT_245379
   00500 Starch and sucrose metabolism
    LACBIDRAFT_245379
Enzymes [BR:lbc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     LACBIDRAFT_245379
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 336 aa AA seqDB search
MKFLRSFGFAAVLFYLPVYVLGGSRTSPPAGAVIVPTSGEFQTISGAVNSLPNDGSSRGI
FVYPGNYTEQVSITRPGPLTIFGYTYDTSTYKSNTVMIQYGLSAKQTGSDDASGTLRVHK
DNFRMYNVNVKNTFGIGSQAIAISQYGNRVGFYGCSFIGYQDTVLAEQGAQVYLKGYIEG
AVDFIFGQTGQAYFGGNVIAVSSKGCVTASGRASNDNTSCRYVFNQNTITLTPGAASGTA
GHVFLGRPWQDFAKVIFLNTVVSAPLNTSLWSVWNAGQPNTDNVFFADFNTTGSGVKGAH
RAKFSTLLTASQAAQYSISSAVGYDYSSWVDTSYVV
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttcttcgctcctttggtttcgccgccgttctcttctacctgccagtgtatgtc
cttggtggctcacgaacgtccccgccggctggggcagtaattgttcctacatcgggagaa
ttccaaaccatctctggggctgtgaattctcttcccaacgatggctcctcaagaggtatc
ttcgtataccccggaaactacacggagcaagtttcaataactcgacctggaccactcacg
atctttggttacacatacgacacatccacctataaatccaacaccgtgatgatccagtat
gggttatctgccaaacaaactgggtcggatgatgcgagtggaactcttcgcgttcacaaa
gacaattttcggatgtacaatgttaacgtgaagaacaccttcggcattggctcccaggcc
atcgcaattagccagtatggaaatcgcgttggcttctatggttgctccttcattggatac
caagatactgttctcgcagagcagggagctcaggtatatttgaaggggtatattgagggt
gcagttgatttcatctttggccaaacaggtcaagcctacttcggaggcaacgtgatcgca
gtatcctcaaaaggatgcgtgactgccagtggccgcgcatccaacgacaatacgagttgt
aggtacgtctttaatcaaaataccatcaccctcactcctggagctgcgtctggaacggct
ggtcatgtttttcttggaaggccgtggcaagattttgcaaaagtcattttcctcaatacc
gtcgtcagtgcccctctgaacacttctctgtggtctgtttggaatgcgggccaaccgaat
accgataacgtcttttttgctgactttaataccactggtagtggtgttaaaggtgctcac
cgtgccaaattttctacccttcttactgcgtcgcaagcagcgcaatactcaatctcgagc
gccgtcggctacgattattcttcatgggtcgacacctcctacgttgtttga

DBGET integrated database retrieval system