KEGG   Laccaria bicolor: LACBIDRAFT_246245Help
Entry
LACBIDRAFT_246245 CDS       T01044                                 

Definition
hypothetical protein
Orthology
K04709  
Acyl-CoA-dependent ceramide synthase [EC:2.3.1.24]
Organism
lbc  Laccaria bicolor
Pathway
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lbc00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    LACBIDRAFT_246245
Enzymes [BR:lbc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.24  sphingosine N-acyltransferase
     LACBIDRAFT_246245
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 384 aa AA seqDB search
MTLCTLTLYSRPFGVHTPDRSASPALNNKRLPRYHNVSPWLRWAVSPVDALKLLTLPLVL
YANWELLAPYLSPGFKNPFAPFFQISGHVDTSDPGDHRYAKSYYDILFLAYHIIFFSGVR
QFITINVSRPIAKYFGLKREAKIDRFGEQAYAMVYFAVFGTWGYSVMTHLPTYWYRTEYF
WIDYPHWNLNLNLKRYYLMQFSYWCQQLLVLLLGLEKPRKDYSELVAHHFVTLWLVGWSY
LFNMTYIGNAVYMSMDIPDTFLAFSKLLNYIQWERAKVISFVIFVGIWTYFRHYLNIIML
WSALFETHLVPYADQPLSDSDYCVYMVSWMPAIIFISIFVLQILNLFWYYLIMKILVRAI
VISEVDDDRSDDEDEEGAEAKKED
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgactctatgtaccctaacattatattccaggccttttggtgtccacacacccgatcgc
agtgcttcccctgcgttgaataataaacgcctccccagataccacaatgtttctccttgg
ttgcgctgggcggtcagccccgttgacgccctgaagcttctaacactccctcttgtgctc
tatgccaattgggaacttctcgcgccctatctttccccaggtttcaaaaacccctttgct
ccctttttccagatatctggtcacgtcgatacctccgatccaggcgatcaccgctacgcg
aaatcttattatgatatactcttcctggcctaccacattatcttcttttctggtgtccgg
cagttcataaccatcaacgtgtctagacctattgccaaatactttggtctgaaacgtgaa
gctaagattgacagatttggcgaacaggcatacgcaatggtttatttcgcggtttttgga
acttggggttattcagtaatgacacacctaccaacctattggtatcgcacggagtatttt
tggattgactatccacattggaatttaaacctgaacttgaagcgttactatctcatgcaa
ttctcttactggtgccagcagctcttggttttgttgcttggactggagaagccacgtaag
gactattcggaacttgtcgcccaccactttgtcaccttgtggttggttggatggagctat
cttttcaacatgacatacattggaaatgcggtgtatatgagcatggatatcccagataca
tttttagcgttttccaaacttttgaattacatccaatgggagcgggccaaagtcatttca
tttgtcattttcgttggaatttggacatacttccgccattatttaaacattataatgctc
tggtccgcactattcgagacacatctcgtcccgtatgcagatcaacccctctccgactca
gattattgtgtttatatggtatcttggatgccagcaatcatcttcatatcaatttttgtc
ttacaaattctcaatctcttctggtattatctgataatgaagatattggtcagggcaatt
gttatcagcgaagtagatgatgatcggtctgatgatgaggatgaggagggggctgaggcc
aagaaggaagactaa

DBGET integrated database retrieval system