KEGG   Laccaria bicolor: LACBIDRAFT_246413Help
Entry
LACBIDRAFT_246413 CDS       T01044                                 

Definition
hypothetical protein
Orthology
K11855  
ubiquitin carboxyl-terminal hydrolase 36/42 [EC:3.1.2.15]
Organism
lbc  Laccaria bicolor
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 312 aa AA seqDB search
SDAIDMTWPASCNSAAGLFNSGNTCFLNSALQCLLHTPPLLRIIISHKTCRMDKGFCMSC
NLREVIVKAYGSKGPVVPSSITNRLQTIAKHMRKGRQEDTHEFLRYAIDALQKSCLAGHS
PKIDPKIAETTWVHKVFGGRLRSRVTCRDCGHNSDTFDSILDLSLDIHKSESLRDALRTF
VAIDYLRGADKYKCEKCKKHVVAEKRFTIHEAPLVLTVHFKRFSPMGRKIGHHINFEEHL
SLKPFMSEGQHGPSYSLYGIICHAGGGPNSGHYYAFVKAKDGQWWEMNDEMRSRVGSAPT
NKKTAYMLFYIR
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
tctgatgctatcgacatgacatggcctgcatcttgcaactctgcagctggactgttcaac
agcggaaatacctgctttcttaacagtgcccttcagtgtctcctgcacacgccgccgcta
ctcagaataataatttcacacaagacatgccgtatggataaagggttttgcatgtcgtgc
aatctccgagaagtgatagtcaaggcctatggatcgaagggtcctgttgtaccttcctcc
ataaccaaccggctacaaaccattgccaagcacatgcgtaaaggcagacaagaggacacc
catgaatttttgcgctatgcgattgacgctctccagaagtcttgtctagctggtcattcg
cctaagatagaccccaaaattgctgaaacaacttgggtacacaaagtttttggcgggcgg
ttgcgctctcgggtgacctgtcgcgattgcggtcataacagcgacacctttgacagcata
ttggatctcagtctagacatccacaagtctgaatcactcagggatgcactgcgaactttt
gtggcaatcgactatctgagaggtgctgacaagtacaagtgtgaaaagtgcaagaaacac
gttgtagcggagaaacgattcactattcatgaagcacccttggtcttaacagttcatttc
aaacgattttcgccaatggggcggaagatcggtcatcacatcaattttgaagaacatctc
tcactcaagccttttatgagtgaaggtcaacatggcccctcatactcgttatatggtatt
atctgccacgctggcggtgggcctaattcagggcattattatgctttcgtaaaggcgaaa
gatggacagtggtgggagatgaacgatgaaatgcggtcgcgcgttggaagtgcaccgacc
aacaaaaagacggcgtacatgctcttctacatccga

DBGET integrated database retrieval system