KEGG   Laccaria bicolor: LACBIDRAFT_246659Help
Entry
LACBIDRAFT_246659 CDS       T01044                                 

Gene name
HAM16203
Definition
histone acetyltransferase, MYST superfamily
Orthology
K11304  
histone acetyltransferase HTATIP [EC:2.3.1.48]
Organism
lbc  Laccaria bicolor
Brite
Enzymes [BR:lbc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     LACBIDRAFT_246659 (HAM16203)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 541 aa AA seqDB search
MVSTPAPVSDGAPPPVSPGGTYALTTVSVGCKIYIQRPGPHGQQEERLAEILSIRDKPVN
PYARRNQPVKDEDSPTKSEDREFFVHWESFNKRLDEWVSGSRLVLSRDLEWPRPKTAAIP
KKVTPSKAPGKVPRLQGSQSLLKKATSNAAMAASPTPGPSTPLFGEEYPSSPSPAPSLKR
KLPHDEEEEEEEEDAEGEDVDAEGEMDVDGEGEVETFDLNLREPIPEAPPLSSFSKEQEI
EKLRTSGSMTQSISEIARVKNLNRLQIGKHEVDAWYFSPYPKEYAHLPVLYICEFCLSFF
PSPMMFSRHRQRCTMLHPPGNEIYRHEDISFYEIDGKRQLTWCRNLSLLSKCFLDHKTLY
YDVTPFMYYVMAKRDSAGCHIIGYFSKEKESAENYNVACILALPQHQRHGYGKLLIEFSY
ELSKKEGKLGSPEKPLSDLGLLGYRAYWAETIIELLINTPDGELSIDDIAQKTSITHADV
MNTCITLQLFKHYKGQHIICLNNTVLEKHQKSKIKRKRRILPEHLKWKPPVFTRDQLRFG
F
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atggtctccactccagcgcctgtcagcgatggcgccccacctcccgtatctcctggcggg
acgtatgcgctgactacagtctcagttggctgtaagatatacattcaacgtcctggtcca
catgggcagcaagaagaacgattggccgagattctttctattcgtgacaaacctgttaat
ccctatgcccgacggaaccaacctgtcaaagatgaagactctccaactaagtctgaggac
cgagaattcttcgtccactgggagtctttcaataagcggctggatgaatgggtttcgggt
tcacgattggtgctgagcagagatttggaatggccacgtccgaagactgctgcgatccca
aagaaggtcaccccttcgaaagccccaggaaaagttccccgtttgcagggttcacagagc
cttttgaagaaggcgacctcaaatgcggccatggctgcatcgccgacgccaggtccatct
acgccgctgtttggagaagagtatccttcatccccatctcctgctccttcgttgaagagg
aaactaccacatgacgaggaagaagaggaagaagaagaggatgcggaaggcgaagatgtg
gatgcggaaggcgaaatggacgtcgacggagagggggaggtggagacctttgatctgaac
cttagggaaccaataccggaggcccctccactctcttctttcagcaaagaacaggagata
gaaaaattgcgtacatctggttcaatgacccaatcaatatctgaaattgcccgagtcaag
aaccttaaccgccttcaaattggaaagcacgaggtcgatgcatggtatttcagtccctat
ccgaaagagtatgcccacttgcccgtgctgtacatctgcgaattctgtctatcctttttc
ccgtccccgatgatgttttcccgccatcgacagcgctgtacaatgttgcacccgcccggc
aatgagatttatcgccacgaagatatttctttctacgagattgacggcaagcggcaactg
acgtggtgtaggaatttgagtttactttccaagtgctttctcgatcataaaacgctgtat
tacgacgtcacccccttcatgtactatgtcatggctaagcgagattccgccggatgccac
attattggctatttttcaaaggaaaaagaatccgctgaaaactacaacgttgcctgcatc
ctagctctccctcagcatcagcgtcacggatatggaaaactcttgatcgagttttcctac
gagttgagcaagaaggaggggaaacttggcagtccagaaaaacctctcagtgacctgggg
ttgttgggttaccgtgcatactgggcggaaactataattgaacttttaatcaacacccct
gacggcgagctgagcattgacgacatcgcgcaaaaaacgtctatcactcatgcagatgtc
atgaatacctgtataaccttacaacttttcaagcattataaaggccagcacataatttgc
ctgaacaacacagtactggagaaacatcagaaatccaagattaaacggaagcgccgaata
ttgcctgaacacttgaaatggaaaccgccagtgttcactcgggatcagttgcggtttggt
ttctaa

DBGET integrated database retrieval system