KEGG   Laccaria bicolor: LACBIDRAFT_247281Help
Entry
LACBIDRAFT_247281 CDS       T01044                                 

Definition
hypothetical protein
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
lbc  Laccaria bicolor
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 472 aa AA seqDB search
MVVDIPPPKRRALGFRRVRTVHDLQPRLDVSPAGRRMGSDGVYLSPLRQLTTNILDTYRI
CNPQFRYESAHNPRRVLTKPSKPAHNDGYDNDDYDYILYVNDWLGTEEGHKYLILDILGQ
GTFGQVVKCQNMKTHEIVAVKVVKNKPAYFNQSMMEVTILELLNKSCDPNDEHHILRLRD
SFIHRSHLCLVFELLSSNLYELIKQNQFQGLSTQLVKVFMAQLLDAMTVLKEARLIHCDL
KPENILLKSLQSPQIKVIDFGSACHERQTVYTYIQSRFYRSPEVLLGMSYTASIDMWSLG
CIAVELFLGLPLFPGTSEYNQLTRIIDMLGLPPLSMLNTGKQTNQFFDVWETYNPQANQT
EKNYRIKSLEQYSREHNTNEQPGKQYFKATSLPEIINTAPMPTSKSARSAHEIEKELNNR
AAFIDFCQGLLNLNPVTRWTPQQARLHPFITGEKYTKPFVVRYSMGRLEHLT
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atggtcgttgacattcctccgccgaagagacgtgccttagggtttcgtcgtgtacggact
gtacatgatctccaacctcgcctcgatgtaagtccggctggtcgtagaatgggtagcgat
ggtgtatatctctcaccgttgcgacaactcaccaccaatattcttgacacgtatcgtatc
tgcaatccgcagttccgatatgaatcggcccataacccacggcgcgttttaacaaagccc
agcaagccagcgcacaatgacggttatgataatgatgactatgactatatcctctacgtc
aatgattggctgggtacggaagagggccacaaatatttaatcctcgatattctgggtcag
ggaaccttcggacaggtcgtaaagtgccagaacatgaagactcatgagattgtcgcggtc
aaggtggttaaaaataagcctgcctatttcaaccagagtatgatggaagtaaccatcttg
gagctgctcaacaaatcctgtgatcctaacgacgagcaccacatacttcgtcttcgcgac
tcttttatccaccgaagtcatctctgtcttgtctttgagcttctctcctctaacctctac
gagcttatcaaacaaaatcaatttcaaggattgagcactcagctcgttaaagtgtttatg
gctcaattattggatgcgatgacggtactgaaagaagctcgccttatacattgcgatcta
aaacccgaaaatatcttgttgaagtccctccaatctcctcaaataaaagttattgacttt
ggatctgcatgtcacgaacgtcagacggtgtacacatatatccaatcacggttttatcgc
tcaccggaggtgctcttggggatgtcctatactgcgtcgatcgacatgtggtcattgggt
tgtattgccgtcgagttgtttctcggattgcctctctttccaggaacaagcgagtataac
caattgacgcgcattattgacatgttgggactgcctcctttgagtatgctaaacacgggc
aagcaaacgaatcaattctttgacgtctgggagacctataatccgcaagccaaccaaacc
gaaaaaaattatcgtataaagagcctggagcagtactcccgggagcacaacacaaacgag
caacctggaaaacagtacttcaaagccacttcgttgcctgagatcatcaacactgctcca
atgccgacatccaagtccgcgcgctcggctcacgaaatagagaaggaattaaataataga
gcggcgtttattgacttctgtcagggtcttttgaatttgaatcctgtcacaagatggacc
cctcaacaagcgagattacatccgttcattactggagagaagtacacaaaaccgtttgtg
gtacgttattctatgggtcgacttgaacatctaacataa

DBGET integrated database retrieval system