KEGG   Laccaria bicolor: LACBIDRAFT_247570Help
Entry
LACBIDRAFT_247570 CDS       T01044                                 

Gene name
HDA16203
Definition
histone deacetylase complex, catalytic component RPD3
Orthology
K11404  
histone deacetylase 3 [EC:3.5.1.98]
Organism
lbc  Laccaria bicolor
Brite
Enzymes [BR:lbc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     LACBIDRAFT_247570 (HDA16203)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 531 aa AA seqDB search
VSYYFPKGVGAQHYGERHPMKPHRLTLTNALVMGYGLDKQIHHIYDPRPATQEELENYHD
HDYIEFLSKVTPQNQGQMRQMIDNFNCVEDCPIFADIYDFCRMYAGGSLAGARKLCAGTT
DIAINWSGGLHHAKRGEASGFCYVNDIVLGILELLRYHPRVLYIDIDIHHGDGVELAFYQ
SNRVMTVSFHKYTGDFFPGTGKLDDNGNGLGKHFCLNVPLLDGIDDDMYLTIFKTVIDDT
VTAFRPSAIVLQCGADSLGCDRLGAFNLSIAAHGECVNFVRKYNVPLLVVGGGGYTIKNV
SRCWTYETSVLVGAEIPDELPATVYDSFFEDSHWKLHPPLTGKVDNQNSPASLQRITISI
RNKLRYLQGAPSVAMQEIPPDLQGLLASEDRTAEEKDEERGTGQAGERRHDPSNGRNEYF
DGNNDVDQDDTSARGRGGTPRRGRGRGRGRGRGRGRAVATPGTTTTHGAEEDDTTAEESV
VPPRRGRGRGRGRGKRGRPPINRDKDKDKDKDNNPTPETPSTPMDVDIDGQ
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
gtgtcctattactttccaaaaggtgttggagctcaacactatggagaaagacatccaatg
aaaccccacagacttactttgacgaatgcgctcgtcatgggatacggacttgataagcag
attcaccacatatacgatcctcggccagcgacgcaagaagaacttgagaattaccatgac
cacgattacattgaattcctatcaaaggtaacacctcaaaaccaagggcaaatgaggcag
atgatcgacaatttcaactgtgttgaggattgtcctatctttgccgacatctatgatttc
tgccgcatgtatgctggaggctctcttgcgggtgctcgaaaattgtgtgcgggtactact
gacattgctattaactggtctggcggcttgcaccatgcaaaacgaggcgaagctagtggc
ttttgctacgtcaacgacattgtgctgggtattctcgaactcctcaggtatcacccccgc
gttctctatattgatattgacattcatcacggagatggtgtcgaactcgctttctatcag
tccaatcgcgtgatgacagtctccttccataaatatactggcgacttcttcccgggaact
gggaaacttgatgacaatgggaacgggctgggcaagcatttctgtctcaatgttcctctc
ctagatggcatcgacgacgacatgtatttgacgatatttaaaaccgtcattgacgatact
gtcacagcattccggccatcagctatcgttctacaatgcggggctgattctctaggttgt
gatcgtcttggcgcattcaatctctctattgctgcgcatggggaatgtgtcaacttcgtt
cgaaaatacaacgtccccctactcgttgtaggcggaggtggctacacaataaaaaatgtt
agccgatgttggacgtacgaaacatctgttctagtcggggcagagataccagacgaacta
ccagccacagtctacgattcattctttgaggattcacactggaaattgcatccgcctctg
actggaaaagtcgataaccagaactctcccgcctcccttcaacgtatcacaataagtata
cgtaataaattacgatacctccagggtgcgcctagtgtggcgatgcaggagattcctcct
gacttgcaaggtctgttggcgagcgaggaccggacggcggaggagaaggacgaagagagg
gggacagggcaagctggcgagcgaagacatgatcccagcaatgggaggaacgaatacttt
gatggtaataacgatgtcgatcaggacgatacgtcggctcgggggagaggcggaactcca
cgacgaggaaggggtagggggagagggcgtggtcgtggtcgtggacgagcggttgcaact
cctggaaccactacaacccatggagcggaagaagacgatacaactgccgaagaaagtgtt
gttccgcctaggagagggcgaggaagaggtaggggccggggaaaacgaggaagacctccg
attaacagggacaaagacaaagacaaagataaggacaataacccaacaccagaaacacca
tccacgcccatggacgttgatattgatggccaatag

DBGET integrated database retrieval system