KEGG   Laccaria bicolor: LACBIDRAFT_247939Help
Entry
LACBIDRAFT_247939 CDS       T01044                                 

Definition
hypothetical protein
Orthology
K13941  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase / dihydropteroate synthase [EC:2.7.6.3 2.5.1.15]
Organism
lbc  Laccaria bicolor
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lbc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    LACBIDRAFT_247939
Enzymes [BR:lbc01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     LACBIDRAFT_247939
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     LACBIDRAFT_247939
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 510 aa AA seqDB search
MHTVAIALGSNLGDRFRNIELALRLLEIPQQLLSSDGQEESDERGEVKAEEDSPLELTAT
VSVVNTSFLYETAPMYVTDQPSFINCACLVETNLPPTTMLRLLKKIEMIVGRVPSIRFGP
RAVDLDLVLYDQQVLDTRELVIPHPRLVEREFVLRPLNDMIPDYIHPIHHKSLRSLLKKT
LTYWTYPNTSHSSAPTHTGNSHGKLNVHHHPKHKSTYLMSTLNATPDSFSDGLTHNTLPT
ALSYARESVSAGAAIIDIGGYSTRPGAAFVGVQEEIDRVVPVVQAIRLAAAEESEKLRHV
LISVDTFRWEVAEAAVRAGANCINDVYAFTGPEYFLERVAREYATPCVLMHSRGEAGQNK
GYKAMYGYAGLRGAVVEGVRVELGQKVNAVVRGRGGVRRWLVVADPGVGFSKTVEGNLEV
LRDAKGVCSGDKKYRNPLAGYPFLIGTSRKSYIGGVLAQGPGGRETVPTERVWATAAGVA
CAVQQGALVVRVHDTREMADVVRMADALWG
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgcatacggtcgctattgccctaggctctaatctcggagaccgattccgaaatatagag
ctcgccttacgcttgctggagatcccacaacagcttctatcatctgatgggcaagaagag
tctgacgaacgaggggaggtgaaggccgaggaagattcgcctttagagttgacagcgacg
gtgtccgtcgtgaacacatcttttttgtatgagacagcaccgatgtacgtcacggaccaa
ccatccttcatcaattgtgcttgtctggtagaaacgaatctcccaccaacgacaatgctc
cgtcttttgaaaaagattgaaatgatcgttgggcgtgtcccatctatccgatttggacca
agagctgtggacctcgatctggtgttgtatgaccaacaagtgcttgacacccgcgagctc
gttattccgcatccaagactggtggagagagaattcgtcttgcggcctttgaatgacatg
attccggattacattcatcctatacaccacaagtccctgcgcagccttttgaagaaaaca
ctcacatactggacttacccaaacacctcccattcttctgcacccacccataccggtaac
tcccacggcaaactgaatgtccaccaccacccaaaacacaagtcaacgtacctgatgagc
acactaaacgcaaccccagactctttctctgacggattgacgcacaacacattaccaacc
gccctgtcctacgcgcgcgagtccgtttcagccggagcggctatcattgatataggtggg
tattccacgcgccctggggcggcgtttgtgggtgtgcaagaggagattgatcgtgttgtg
ccggttgtacaagctatacggcttgctgcggccgaagagtcggagaagctgaggcatgta
ctgatcagtgtggatacgttcaggtgggaggtggcagaggcggctgttagagcaggggcg
aactgcattaacgacgtttatgcgttcactgggccggagtatttcttggaacgtgttgcg
agggaatatgcgaccccatgtgtgcttatgcattctcgaggggaggcggggcagaataaa
gggtataaagccatgtatgggtacgctgggctgagaggggcggttgttgagggtgtgagg
gttgagttggggcagaaggtgaatgcggttgtgagagggcggggaggggtgaggaggtgg
ttggttgttgcggaccctggggttgggtttagtaagactgttgaaggaaatttggaggtt
ttgagggatgcgaagggggtgtgttcaggtgataaaaaatatcggaacccgcttgctggg
tacccattcctcattgggacgtcgaggaagtcgtatattggcggtgtgttggcacaagga
ccggggggacgggagactgtaccgactgagagggtgtgggctacggctgcgggggtggcg
tgtgccgttcagcagggggcgttggttgtgagggtgcatgatacgagggaaatggcggat
gtggttaggatggctgatgctttgtggggttga

DBGET integrated database retrieval system