KEGG   Laccaria bicolor: LACBIDRAFT_248389Help
Entry
LACBIDRAFT_248389 CDS       T01044                                 

Definition
hypothetical protein
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
lbc  Laccaria bicolor
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lbc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    LACBIDRAFT_248389
Enzymes [BR:lbc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     LACBIDRAFT_248389
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 527 aa AA seqDB search
LTFTHSVASGDPFDSSVILWTRAVPKSLDGTTLLPDQSVPACVSYRVYTFPTLSGKPVSS
GEAFTSYDVDWTVKVEATGLKPDTKYFFQFADCANVQTVSPVGMTRTIATAAKHVNGGDP
LTFAVFSCSQYQSGWFNAYGFAARNTSADIFVHLGDYIYEYVQGGASIGRTVLGRELATI
HDYRQRLNQYRTDASLVAAHAKAPWITDDHEVADNTWKAGSANSNDSASGCTWSPSGACF
TDRKFAAIRAYHEWMPIRQVDASDKLRIWRNFKIGKLLDLTMLDTRVYDRDLTDQLNHCD
VVVNSIAAFPNRSIMGLAQEKWLYDTISRSQERGAVWRVIGQQIVFSQLNFGGSFDLVRP
SADAWDGYRANRGRVLDHLYRNKIKNTVILSGDSHANWVSDLAHPNDTVTYNPKTGAGSI
GVEFAGTAVTSPSAFGAWITPAAANNISRQLVAINSDLQWSEASYRGFFTLTIDSETLNA
TYYAMNNISFANLDGFASANFVVSNGENKLSRPVAGGVVKASVLKDV
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
ctgactttcacgcactcagtagcaagtggagaccccttcgactcatccgtcatcctctgg
acacgtgccgtgcccaaatctctcgacggaacgaccttgctacctgatcaaagcgtcccc
gcgtgtgtctcttacagggtatatacattccccacgctctcaggtaaacctgtaagctcg
ggtgaggccttcacgagctacgacgtcgattggacggtcaaggtagaggctacgggcctg
aaaccagacaccaagtatttctttcaattcgcagattgtgcaaatgtgcagacggttagc
ccagtcgggatgacaaggactatcgctactgctgcgaagcatgttaacggtggcgatccg
ctgacctttgctgtattctcttgctctcaatatcagtctggttggttcaatgcttatggc
tttgcggcacgcaacaccagtgctgatatcttcgtccatctcggagactacatatacgaa
tatgttcagggaggtgcttcgattggtcgcaccgtcctagggcgggaattagcaactatc
catgattaccgtcagaggttgaaccagtacaggaccgatgcgagcctcgtggctgcgcat
gccaaagctccttggattactgacgaccatgaagttgcagacaacacctggaaagctggt
tccgcaaattccaacgactctgcatcaggatgcacctggtccccctcaggggcatgcttc
acagatagaaagttcgctgccattcgcgcgtaccacgaatggatgcccattcgccaggtg
gatgcgagcgataaattgagaatttggaggaattttaagattgggaaattgttggatttg
acgatgctggatacgcgtgtgtatgacagggatctgacggatcaattgaatcactgtgat
gtagtcgtcaatagtattgcggctttccctaaccgttccattatgggattggcacaagaa
aaatggctctatgacacaatatctcgttcacaagaacggggcgctgtctggcgcgtgata
ggtcaacagatcgtcttttcccaattaaactttggaggatctttcgacttggtgagaccc
tcagccgatgcatgggacggctaccgtgcaaatcgcggacgtgttttggaccatctttac
cggaacaaaataaagaacaccgtcattttgtcaggggacagccacgccaactgggtttct
gacctcgctcatccaaacgacacagtgacctacaaccccaagacgggtgctggctccatt
ggtgtcgaattcgcgggcacagcagtgacctccccgtccgcttttggcgcatggatcaca
ccagcagcagctaacaacatttcccgacaactcgtagccatcaactccgatcttcagtgg
agcgaagcatcttacaggggctttttcacgttgacgattgatagcgagacgttgaatgcg
acatattatgcgatgaataatatcagtttcgcaaacttggacggtttcgcaagcgccaat
tttgttgtgagcaatggagagaataaactttcgaggcctgttgctgggggcgttgttaaa
gctagtgttttgaaggacgtgtag

DBGET integrated database retrieval system