KEGG   Laccaria bicolor: LACBIDRAFT_249166Help
Entry
LACBIDRAFT_249166 CDS       T01044                                 

Definition
(RefSeq) hypothetical protein
  KO
K05610  ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
lbc  Laccaria bicolor
Brite
Enzymes [BR:lbc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     LACBIDRAFT_249166
Peptidases [BR:lbc01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   LACBIDRAFT_249166
Ubiquitin system [BR:lbc04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UCH
    LACBIDRAFT_249166
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C12
Motif
Other DBs
NCBI-GeneID: 6075986
NCBI-ProteinID: XP_001880246
JGI: 249166
UniProt: B0D919
AA seq 294 aa AA seqDB search
MIDLVGGPFAVIESDPGNVIQSLEIQLNNEIPGVFTSLTRRLGIRGLELIELYDIEPWAT
DHLSPRGLIFCFMWRKDAHRPTDFNDPAADRVWFANQLSDDACATHAILNVVLNCPGVEL
GEELRMFKEETERMSPVIRGLAITNSPTIRQAHNSLARSEKAKAKGDEEEEEGAEETYHF
IGYVPAFGKVWELDGLKSGPLEVGDPTSEWMSTVRPALRLKMSKYGASPTDSGSNIRFSL
LAIVDGGYEGASDEFELGKRERVALERRLDACQEGEGWRGMVCLFLLSFFLEGC
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgatcgacctcgtcggtgggccattcgccgttatcgaaagtgacccaggtaatgtcatc
caatctctcgaaatacaactcaataacgaaataccaggcgtattcacatccctcacccga
cgtttgggcatacgtggtctagagctcatcgagctctacgacatcgaaccatgggcaaca
gaccacctctccccccgaggcctcatcttctgcttcatgtggcgtaaagacgcccaccgt
ccaactgactttaacgatcccgctgcagacagagtctggttcgccaatcagctgagcgac
gacgcgtgtgcaactcatgctattctgaacgtcgttttgaattgccccggcgtggagttg
ggtgaggagttgaggatgtttaaggaggagacggagaggatgtcgcctgttataagaggt
ttggcgataacaaactctccaaccatccgacaagcacacaactcactagcacggtccgaa
aaagccaaagccaaaggagacgaagaagaagaagaaggagcagaagaaacgtatcacttc
ataggctacgtcccagcattcggtaaagtctgggaactcgacgggttaaaatccgggcca
ttagaagtcggggaccccacatccgaatggatgtcaacagtccgccccgccctccggctc
aaaatgtccaaatacggcgcctcacccaccgactcggggtccaacatccgttttagcctc
ttagcgatcgtggatggggggtatgaaggtgcgagtgatgagtttgagcttgggaaaagg
gagagggttgcgttggaacggcggttggatgcgtgtcaagagggggaggggtggaggggg
atggtttgtcttttccttctttccttttttttggaggggtgctaa

DBGET integrated database retrieval system