KEGG   Laccaria bicolor: LACBIDRAFT_250005Help
Entry
LACBIDRAFT_250005 CDS       T01044                                 

Definition
hypothetical protein
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
lbc  Laccaria bicolor
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 362 aa AA seqDB search
MDERMENFITGNTYSPLDVIGEGAYGIVCSAIHLPTQRKVAIKRIAPFEHSMFCLRTLRE
IKLLRHFRHENIIRILDILYPPSVYDFNEVYLVQELMETDLHRVIRTQELSDDHCQYFIY
QTLRALKALHSADVLHRDLKPSNLLLNSNCDLKICDFGLARSARPPPDIDDTSTFMTEYV
ATRWYRAPEVMLTFKEYTRAIDMWSVGCVLAEMLSGRPLFPGRDYHHQLSLILETLGTPS
IDDFYAINSSRSREYIRALPFKKKKSFAQMFPNANPLAIDLMEKCLTFSPKRRLQVSEAL
QHPYLQPYHDPEDEPTAQPLDPAFFDFDFGDPLPKEQLKVLIYEEITRSDDGRPPLPLAE
YR
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atggatgaacgcatggaaaacttcatcaccggaaatacctacagccccctcgatgtcatc
ggcgaaggcgcgtacggcatcgtttgctcagcaatacacctgccaactcagcgtaaagtt
gcaatcaaacgcatcgcaccctttgagcattccatgttctgtctgagaacccttcgcgag
atcaagcttctgcgccactttcgtcacgaaaacatcattcgcatacttgacatcctttac
cccccaagtgtttatgatttcaatgaggtgtatcttgtgcaggagttgatggagaccgat
ctgcatcgtgtcatccggacacaggaactcagcgacgaccactgccagtacttcatatac
caaaccttgcgcgctttgaaagcgcttcattccgcggacgtcctccaccgggatttaaaa
ccgtcgaatcttttgctcaattccaattgtgatctcaagatctgtgactttggcctggct
cgctctgctcgtccgccacccgacattgacgacacgagtacattcatgaccgaatacgtc
gctacccggtggtaccgtgcaccagaagttatgcttacctttaaagaatacactcgcgcc
atcgatatgtggagtgtcggatgtgttttggctgagatgttgagcggaagacctctcttt
ccgggccgggattatcatcaccagctttcattaattctcgaaaccctcgggaccccttcg
atagacgacttttacgcgatcaactcctcaaggtcacgagaatatattcgggcactacct
tttaaaaagaaaaagagctttgcgcaaatgttcccaaacgcaaatccacttgctattgac
ctaatggaaaaatgcttgactttcagcccaaaacgacgtctgcaagtttcggaagccctg
caacatccttacctacagccctaccacgatcccgaagatgaacccactgcccaaccccta
gatccagcgttctttgactttgactttggtgatccgttgccaaaggagcagctcaaagtg
ctcatatacgaagagattacacgatcggacgatggacggcctccgctccccctcgctgaa
tacagataa

DBGET integrated database retrieval system