KEGG   Laccaria bicolor: LACBIDRAFT_250005Help
Entry
LACBIDRAFT_250005 CDS       T01044                                 

Definition
hypothetical protein
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
lbc  Laccaria bicolor
Brite
Enzymes [BR:lbc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     LACBIDRAFT_250005
Protein kinases [BR:lbc01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   LACBIDRAFT_250005
Exosome [BR:lbc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   LACBIDRAFT_250005
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 362 aa AA seqDB search
MDERMENFITGNTYSPLDVIGEGAYGIVCSAIHLPTQRKVAIKRIAPFEHSMFCLRTLRE
IKLLRHFRHENIIRILDILYPPSVYDFNEVYLVQELMETDLHRVIRTQELSDDHCQYFIY
QTLRALKALHSADVLHRDLKPSNLLLNSNCDLKICDFGLARSARPPPDIDDTSTFMTEYV
ATRWYRAPEVMLTFKEYTRAIDMWSVGCVLAEMLSGRPLFPGRDYHHQLSLILETLGTPS
IDDFYAINSSRSREYIRALPFKKKKSFAQMFPNANPLAIDLMEKCLTFSPKRRLQVSEAL
QHPYLQPYHDPEDEPTAQPLDPAFFDFDFGDPLPKEQLKVLIYEEITRSDDGRPPLPLAE
YR
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atggatgaacgcatggaaaacttcatcaccggaaatacctacagccccctcgatgtcatc
ggcgaaggcgcgtacggcatcgtttgctcagcaatacacctgccaactcagcgtaaagtt
gcaatcaaacgcatcgcaccctttgagcattccatgttctgtctgagaacccttcgcgag
atcaagcttctgcgccactttcgtcacgaaaacatcattcgcatacttgacatcctttac
cccccaagtgtttatgatttcaatgaggtgtatcttgtgcaggagttgatggagaccgat
ctgcatcgtgtcatccggacacaggaactcagcgacgaccactgccagtacttcatatac
caaaccttgcgcgctttgaaagcgcttcattccgcggacgtcctccaccgggatttaaaa
ccgtcgaatcttttgctcaattccaattgtgatctcaagatctgtgactttggcctggct
cgctctgctcgtccgccacccgacattgacgacacgagtacattcatgaccgaatacgtc
gctacccggtggtaccgtgcaccagaagttatgcttacctttaaagaatacactcgcgcc
atcgatatgtggagtgtcggatgtgttttggctgagatgttgagcggaagacctctcttt
ccgggccgggattatcatcaccagctttcattaattctcgaaaccctcgggaccccttcg
atagacgacttttacgcgatcaactcctcaaggtcacgagaatatattcgggcactacct
tttaaaaagaaaaagagctttgcgcaaatgttcccaaacgcaaatccacttgctattgac
ctaatggaaaaatgcttgactttcagcccaaaacgacgtctgcaagtttcggaagccctg
caacatccttacctacagccctaccacgatcccgaagatgaacccactgcccaaccccta
gatccagcgttctttgactttgactttggtgatccgttgccaaaggagcagctcaaagtg
ctcatatacgaagagattacacgatcggacgatggacggcctccgctccccctcgctgaa
tacagataa

DBGET integrated database retrieval system