KEGG   Laccaria bicolor: LACBIDRAFT_252993Help
Entry
LACBIDRAFT_252993 CDS       T01044                                 

Gene name
R2
Definition
(RefSeq) tyrosinase
  KO
K00505  tyrosinase [EC:1.14.18.1]
Organism
lbc  Laccaria bicolor
Pathway
lbc00350  Tyrosine metabolism
lbc01100  Metabolic pathways
lbc01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lbc00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    LACBIDRAFT_252993 (R2)
Enzymes [BR:lbc01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.1  tyrosinase
     LACBIDRAFT_252993 (R2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tyrosinase DUF3071
Motif
Other DBs
NCBI-GeneID: 6081174
NCBI-ProteinID: XP_001885552
JGI: 252993
UniProt: B0DNR7
AA seq 343 aa AA seqDB search
MPNRHYRKLAFTLALALIQISKQALDWDAQEDECSHFLVRQEWRSLSQAHKAEYIAAVKC
TQSLPARSGFEAAQTRFDDFQAVHINVADEIHIVGHFLPWHRRFIKIHETTLREECGYRG
AIPYWDWTLDADSLDSISESPIFDPVHGFGGDGVPGTYILPNDPDGTSELFPETFVGCVQ
DGPFASHKLHIGPGKLSTDHCLVRGLNDTYKGFLTSEAVAQTMEQPTFELFRVQLEGGGS
NPYPAQHGSGHLIVGGDMGNLFSSPGDPLFHLHHANLDRLWWQWQEKDLPTRFLDISGRL
HANSPRLTQVTLNYRLDFHTLAPPMSVRDTMDIQKPPFCYAYV
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgcccaaccgtcactatcgcaagctcgcctttacactcgccctcgccttgattcaaatt
tcaaagcaggcactggactgggatgcacaagaggacgagtgttcccacttcctcgtgcga
caggaatggagatcgctcagccaagcccacaaagcagagtatatcgccgcagtcaagtgt
acccaaagtctccccgcgagaagtggtttcgaggcagcacaaacgcgttttgacgatttt
caggcggttcacatcaacgtcgctgatgaaattcacattgtgggccattttttaccatgg
catcgccgtttcataaaaatccacgagacaacgcttcgggaggaatgtgggtacagaggg
gcaataccatattgggattggacgctcgacgccgatagccttgactctatcagtgaatcg
cccatcttcgaccccgtccatggatttggtggtgacggcgtcccgggcacctacattctt
cccaatgaccctgatggcacgtccgagctttttcccgagacgtttgtcggctgcgtgcag
gacggtccttttgcttctcacaaacttcacattggcccaggaaaactgagtacggatcat
tgccttgtacgagggctcaacgacacatacaagggtttcctaacatcagaggcggtcgct
caaaccatggaacaacctacttttgagctgttccgtgtgcagctcgaaggaggagggtcg
aatccgtatcccgctcaacatggatctggtcatctcatcgtagggggtgatatgggaaat
ttgttttcgagtcctggtgacccgctcttccacctccaccatgcaaatctggataggctt
tggtggcaatggcaagagaaggatctaccgacacgcttcctcgacatctctggtcgcttg
catgccaacagtcccagattaacacaggttaccttgaattatcggcttgacttccatacg
ctggctcctccaatgtcagttcgggatacgatggacattcagaaacctcccttttgttac
gcctatgtctaa

DBGET integrated database retrieval system