KEGG   Laccaria bicolor: LACBIDRAFT_252993Help
Entry
LACBIDRAFT_252993 CDS       T01044                                 

Gene name
R2
Definition
tyrosinase (EC:1.14.18.1)
Orthology
K00505  
tyrosinase [EC:1.14.18.1]
Organism
lbc  Laccaria bicolor
Pathway
Tyrosine metabolism
Riboflavin metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lbc00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    LACBIDRAFT_252993 (R2)
  Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    LACBIDRAFT_252993 (R2)
Enzymes [BR:lbc01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.1  tyrosinase
     LACBIDRAFT_252993 (R2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 343 aa AA seqDB search
MPNRHYRKLAFTLALALIQISKQALDWDAQEDECSHFLVRQEWRSLSQAHKAEYIAAVKC
TQSLPARSGFEAAQTRFDDFQAVHINVADEIHIVGHFLPWHRRFIKIHETTLREECGYRG
AIPYWDWTLDADSLDSISESPIFDPVHGFGGDGVPGTYILPNDPDGTSELFPETFVGCVQ
DGPFASHKLHIGPGKLSTDHCLVRGLNDTYKGFLTSEAVAQTMEQPTFELFRVQLEGGGS
NPYPAQHGSGHLIVGGDMGNLFSSPGDPLFHLHHANLDRLWWQWQEKDLPTRFLDISGRL
HANSPRLTQVTLNYRLDFHTLAPPMSVRDTMDIQKPPFCYAYV
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgcccaaccgtcactatcgcaagctcgcctttacactcgccctcgccttgattcaaatt
tcaaagcaggcactggactgggatgcacaagaggacgagtgttcccacttcctcgtgcga
caggaatggagatcgctcagccaagcccacaaagcagagtatatcgccgcagtcaagtgt
acccaaagtctccccgcgagaagtggtttcgaggcagcacaaacgcgttttgacgatttt
caggcggttcacatcaacgtcgctgatgaaattcacattgtgggccattttttaccatgg
catcgccgtttcataaaaatccacgagacaacgcttcgggaggaatgtgggtacagaggg
gcaataccatattgggattggacgctcgacgccgatagccttgactctatcagtgaatcg
cccatcttcgaccccgtccatggatttggtggtgacggcgtcccgggcacctacattctt
cccaatgaccctgatggcacgtccgagctttttcccgagacgtttgtcggctgcgtgcag
gacggtccttttgcttctcacaaacttcacattggcccaggaaaactgagtacggatcat
tgccttgtacgagggctcaacgacacatacaagggtttcctaacatcagaggcggtcgct
caaaccatggaacaacctacttttgagctgttccgtgtgcagctcgaaggaggagggtcg
aatccgtatcccgctcaacatggatctggtcatctcatcgtagggggtgatatgggaaat
ttgttttcgagtcctggtgacccgctcttccacctccaccatgcaaatctggataggctt
tggtggcaatggcaagagaaggatctaccgacacgcttcctcgacatctctggtcgcttg
catgccaacagtcccagattaacacaggttaccttgaattatcggcttgacttccatacg
ctggctcctccaatgtcagttcgggatacgatggacattcagaaacctcccttttgttac
gcctatgtctaa

DBGET integrated database retrieval system